DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and LOC100005446

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001344501.3 Gene:LOC100005446 / 100005446 -ID:- Length:584 Species:Danio rerio


Alignment Length:266 Identity:52/266 - (19%)
Similarity:80/266 - (30%) Gaps:110/266 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAF---------------CRGCINEWLTRQP 51
            |:.......:::::..|..|..:|..|.|| .|.|.|               |..||.|.:..:|
Zfish    18 GFPKKILANKLEDKHLCNCCQNILRRPFQA-QCGHRFCSYCFNRTVGSGPQKCNACIKEDIFEEP 81

  Fly    52 T------CPVDRNSLTTANLRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYN-SHLDEC--- 106
            |      |....|:            .|..:..|...|.|.  ||:....:..|. ||..:|   
Zfish    82 TSILKQGCAFPDNA------------ARREVENLPAVCFNE--GCSWKGSIKDYELSHEGKCEFM 132

  Fly   107 -----------------IHN------------------------------PKRPFPCEKGCG-FD 123
                             .||                              ||.|..|| ||. ..
Zfish   133 ILPCPLCKELIRFNEQERHNERECPERTLNCKYCKEPFHFKNIKAHDEICPKYPMICE-GCAKKK 196

  Fly   124 IPKDELKDH-NCVRELRT----------LIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFM 177
            ||:::..|| ....:.||          ::|:: ||:.|.:.....:         .|.|...::
Zfish   197 IPREKYVDHIKFCSKFRTPCRYHVVGCDMLVEK-EKIHEHERACAHE---------HLNLLLHYI 251

  Fly   178 RAMRVS 183
            ..|:||
Zfish   252 MGMKVS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 16/58 (28%)
Sina 83..>157 CDD:302762 27/136 (20%)
USP8_interact 137..315 CDD:286082 11/57 (19%)
LOC100005446XP_001344501.3 RING 36..69 CDD:214546 8/33 (24%)
zf-TRAF 178..235 CDD:280357 16/58 (28%)
TRAF_BIRC3_bd 350..412 CDD:293278
MATH 419..580 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.