Sequence 1: | NP_001261904.1 | Gene: | elgi / 39735 | FlyBaseID: | FBgn0283649 | Length: | 315 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001343919.2 | Gene: | rnf151 / 100004674 | ZFINID: | ZDB-GENE-121214-234 | Length: | 243 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 89/206 - (43%) | Gaps: | 43/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTANLR 66
Fly 67 AVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFP---------------- 115
Fly 116 ---------------CEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKM----GELKSELTDQQL 161
Fly 162 TINELKRELQL 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
elgi | NP_001261904.1 | RING | 17..55 | CDD:238093 | 16/37 (43%) |
Sina | 83..>157 | CDD:302762 | 21/108 (19%) | ||
USP8_interact | 137..315 | CDD:286082 | 8/40 (20%) | ||
rnf151 | XP_001343919.2 | RING_Ubox | 20..58 | CDD:327409 | 17/38 (45%) |
zf-TRAF | 102..157 | CDD:280357 | 7/60 (12%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0297 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D918518at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |