DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and rnf151

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001343919.2 Gene:rnf151 / 100004674 ZFINID:ZDB-GENE-121214-234 Length:243 Species:Danio rerio


Alignment Length:206 Identity:53/206 - (25%)
Similarity:89/206 - (43%) Gaps:43/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTANLR 66
            ||:|::|....|::|.|.||..||..|:: :.|.|.||:.||.:|:.||..||..|.|:....:.
Zfish     4 GYEVDQFVDPPDDDLICVICRAVLRCPVR-LKCNHVFCKECILQWMKRQVKCPCCRQSIDQNQML 67

  Fly    67 AVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFP---------------- 115
            .:.::.:: :.|||:.|.|...||.|...|.....|:..|      |:.                
Zfish    68 VLFKLSKS-IGRLSVKCRNGQQGCRATFPLSNEYLHISTC------PYEWQICPHEGCGQQVLRK 125

  Fly   116 ---------------CEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKM----GELKSELTDQQL 161
                           |..|||..:.::....|||.|||:...:.:..|.    ..|:.::...|.
Zfish   126 DVQAHDQSCTHWRQLCPMGCGTLLVRENQTQHNCYRELQQRYLAERRKQRAIAANLRRKMQRMQS 190

  Fly   162 TINELKRELQL 172
            .:.::||::.|
Zfish   191 RMAQIKRQINL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 16/37 (43%)
Sina 83..>157 CDD:302762 21/108 (19%)
USP8_interact 137..315 CDD:286082 8/40 (20%)
rnf151XP_001343919.2 RING_Ubox 20..58 CDD:327409 17/38 (45%)
zf-TRAF 102..157 CDD:280357 7/60 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.