DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GXIVsPLA2 and PLA2G12B

DIOPT Version :9

Sequence 1:NP_001261903.1 Gene:GXIVsPLA2 / 39734 FlyBaseID:FBgn0036545 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_115951.2 Gene:PLA2G12B / 84647 HGNCID:18555 Length:195 Species:Homo sapiens


Alignment Length:196 Identity:60/196 - (30%)
Similarity:91/196 - (46%) Gaps:55/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AYSGYGSSTIVHLRDAIIAAEAIFGDVFKNLIVLVRKFRTVHEVFDAAVD----EN--CIYQC-- 75
            :||.:|   :.|||.:                     |.:|:..||:.::    :|  |.|:|  
Human    30 SYSDWG---LRHLRGS---------------------FESVNSYFDSFLELLGGKNGVCQYRCRY 70

  Fly    76 ---PAPDIGGPAPRAVQNKFYTP-TADGCGS--LGLRI--STDY-LPAKEMETCCNDHDICYDTC 131
               |.|..|           |.| ..:||||  |||::  |.|. :||  |..|||..|:|||||
Human    71 GKAPMPRPG-----------YKPQEPNGCGSYFLGLKVPESMDLGIPA--MTKCCNQLDVCYDTC 122

  Fly   132 NSDKELCDLDFKRCLYKYCDSYEKSIA-SDLMMKGCKAAAKMLFTGTLTLGCRSYLDSQQRSCYC 195
            .::|..||..|:.||:..|...::|:. ...:...|.:....:|....|||||.:::||:.:|.|
Human   123 GANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACIC 187

  Fly   196 A 196
            |
Human   188 A 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GXIVsPLA2NP_001261903.1 Phospholip_A2_3 18..199 CDD:421899 60/196 (31%)
PLA2G12BNP_115951.2 PLA2G12 12..195 CDD:311102 60/196 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157586
Domainoid 1 1.000 87 1.000 Domainoid score I8003
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5144
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299904at2759
OrthoFinder 1 1.000 - - FOG0003743
OrthoInspector 1 1.000 - - otm42250
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12824
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5673
SonicParanoid 1 1.000 - - X2603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.990

Return to query results.
Submit another query.