DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GXIVsPLA2 and Pla2g12b

DIOPT Version :9

Sequence 1:NP_001261903.1 Gene:GXIVsPLA2 / 39734 FlyBaseID:FBgn0036545 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_006514124.1 Gene:Pla2g12b / 69836 MGIID:1917086 Length:244 Species:Mus musculus


Alignment Length:157 Identity:50/157 - (31%)
Similarity:80/157 - (50%) Gaps:28/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FRTVHEVFDAAVD----EN--CIYQC-----PAPDIGGPAPRAVQNKFYTPTADGCGS--LGLRI 107
            |.:|:...|:.::    :|  |.|:|     |.|..|          :.....:||.|  ||:::
Mouse    93 FESVNSYVDSFMELLGGKNGVCQYRCRYGKAPMPRPG----------YKAQEPNGCSSYFLGIKV 147

  Fly   108 --STDY-LPAKEMETCCNDHDICYDTCNSDKELCDLDFKRCLYKYCDSYEKSIASDLMMKGCKAA 169
              |.|. :||  |..|||..|:|||||.::|..||..|:.||:..|...::|:.....::.|.:.
Mouse   148 PGSMDLGIPA--MTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEACDSL 210

  Fly   170 AKMLFTGTLTLGCRSYLDSQQRSCYCA 196
            |..:|....|||||.:::||:.:|.||
Mouse   211 ADTVFNTVWTLGCRPFMNSQRAACICA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GXIVsPLA2NP_001261903.1 Phospholip_A2_3 18..199 CDD:421899 50/157 (32%)
Pla2g12bXP_006514124.1 PLA2G12 68..244 CDD:311102 50/157 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847992
Domainoid 1 1.000 89 1.000 Domainoid score I7841
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5109
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299904at2759
OrthoFinder 1 1.000 - - FOG0003743
OrthoInspector 1 1.000 - - otm44303
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12824
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5673
SonicParanoid 1 1.000 - - X2603
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.990

Return to query results.
Submit another query.