DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GXIVsPLA2 and pla2g12b

DIOPT Version :9

Sequence 1:NP_001261903.1 Gene:GXIVsPLA2 / 39734 FlyBaseID:FBgn0036545 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_012821914.1 Gene:pla2g12b / 493298 XenbaseID:XB-GENE-1015653 Length:200 Species:Xenopus tropicalis


Alignment Length:158 Identity:55/158 - (34%)
Similarity:80/158 - (50%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FRTVHEVFDAAVD----EN--CIYQC-------PAPDIGGPAPRAVQNKFYTPTADGCGS--LGL 105
            |..|:..||:.::    .|  |.|:|       |.||...|.|            :||.|  |||
 Frog    49 FEAVNGYFDSFLELLGGRNGVCQYKCRYGKAPLPRPDYKSPEP------------NGCSSYFLGL 101

  Fly   106 RI--STDY-LPAKEMETCCNDHDICYDTCNSDKELCDLDFKRCLYKYCDSYEKSIASDLMMKGCK 167
            ::  |.|. :||  |..|||..|||||||.::|..||..|:.||:..|...:||:.....::.|:
 Frog   102 KVPESMDLGIPA--MTKCCNQLDICYDTCGANKYRCDAKFRWCLHAICSDLKKSLGFVSKVEACE 164

  Fly   168 AAAKMLFTGTLTLGCRSYLDSQQRSCYC 195
            :.|..:|....||||:.:::||:.||.|
 Frog   165 SVADTVFNTVWTLGCKPFMNSQRSSCIC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GXIVsPLA2NP_001261903.1 Phospholip_A2_3 18..199 CDD:421899 55/158 (35%)
pla2g12bXP_012821914.1 PLA2G12 11..200 CDD:311102 55/158 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7716
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I4969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299904at2759
OrthoFinder 1 1.000 - - FOG0003743
OrthoInspector 1 1.000 - - otm49479
Panther 1 1.100 - - O PTHR12824
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5673
SonicParanoid 1 1.000 - - X2603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.