DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GXIVsPLA2 and pla2g12b

DIOPT Version :9

Sequence 1:NP_001261903.1 Gene:GXIVsPLA2 / 39734 FlyBaseID:FBgn0036545 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_005156576.1 Gene:pla2g12b / 406739 ZFINID:ZDB-GENE-040426-2771 Length:235 Species:Danio rerio


Alignment Length:165 Identity:52/165 - (31%)
Similarity:83/165 - (50%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FGDVFKNLIVLVRKFRTVHEVFDAAV------DENCIYQCPAPDIGGPAPRAVQNKFYTPTADGC 100
            ||.:..:|       ::|:..||:.:      |..|.|:|..    |.||:. :..:.....|||
Zfish    77 FGSIRGSL-------QSVNGYFDSILELMGGRDGVCQYRCRY----GKAPQP-RPGYQMSEPDGC 129

  Fly   101 GS--LGLRISTDY---LPAKEMETCCNDHDICYDTCNSDKELCDLDFKRCLYKYCDSYEKSIASD 160
            .:  ||.::...:   :||  |..|||..||||:||.|:|..||..|:.||:..|...:||:...
Zfish   130 STSLLGFQVPNSFDMGVPA--MTKCCNQLDICYETCGSNKYRCDTKFRWCLHSICGDLKKSLGLM 192

  Fly   161 LMMKGCKAAAKMLFTGTLTLGCRSYLDSQQRSCYC 195
            ..::.|:..|..::....|||||.:::.|:.||||
Zfish   193 SKVEACETFADTMYNTVWTLGCRPFMNGQRASCYC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GXIVsPLA2NP_001261903.1 Phospholip_A2_3 18..199 CDD:421899 52/165 (32%)
pla2g12bXP_005156576.1 PLA2G12 68..235 CDD:284389 52/165 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593383
Domainoid 1 1.000 87 1.000 Domainoid score I7979
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5126
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299904at2759
OrthoFinder 1 1.000 - - FOG0003743
OrthoInspector 1 1.000 - - otm25996
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12824
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5673
SonicParanoid 1 1.000 - - X2603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.990

Return to query results.
Submit another query.