DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GXIVsPLA2 and pla2g12a

DIOPT Version :9

Sequence 1:NP_001261903.1 Gene:GXIVsPLA2 / 39734 FlyBaseID:FBgn0036545 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001076268.1 Gene:pla2g12a / 402802 ZFINID:ZDB-GENE-070410-18 Length:198 Species:Danio rerio


Alignment Length:133 Identity:46/133 - (34%)
Similarity:70/133 - (52%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DENCIYQC--PAPDIG-GPAPRAVQNKFYTPTADGCGS--LGLRISTDYLPAKEMETCCNDHDIC 127
            |..|.:.|  .:.||. .|.||.   .:..|..:||||  .|.:.... :|:  |..|||:||.|
Zfish    64 DGQCQFTCGDGSSDIRYTPVPRP---NYRPPPPNGCGSPLFGFQFDVG-IPS--MTRCCNEHDRC 122

  Fly   128 YDTCNSDKELCDLDFKRCLYKYCDSYEKSIASDLMMKGCKAAAKMLFTGTLTLGCRSYLDSQQRS 192
            ||:|..:|..||..|:.||...|.:.:.::.....::.|::|..:||...:.|||:.|||||:.:
Zfish   123 YDSCGREKSDCDEQFQLCLENICQNLQMTLGLSQSVQACESAVTVLFDTVMHLGCKPYLDSQRSA 187

  Fly   193 CYC 195
            |.|
Zfish   188 CIC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GXIVsPLA2NP_001261903.1 Phospholip_A2_3 18..199 CDD:421899 46/133 (35%)
pla2g12aNP_001076268.1 PLA2G12 16..198 CDD:284389 46/133 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593384
Domainoid 1 1.000 87 1.000 Domainoid score I7979
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5126
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299904at2759
OrthoFinder 1 1.000 - - FOG0003743
OrthoInspector 1 1.000 - - otm25996
orthoMCL 1 0.900 - - OOG6_106593
Panther 1 1.100 - - LDO PTHR12824
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5673
SonicParanoid 1 1.000 - - X2603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.