DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GXIVsPLA2 and Pla2g12b

DIOPT Version :9

Sequence 1:NP_001261903.1 Gene:GXIVsPLA2 / 39734 FlyBaseID:FBgn0036545 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_346132.5 Gene:Pla2g12b / 367415 RGDID:1588484 Length:195 Species:Rattus norvegicus


Alignment Length:159 Identity:53/159 - (33%)
Similarity:81/159 - (50%) Gaps:31/159 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FRTVHEVFDAAVD----EN--CIYQC-----PAPDIGGPAPRAVQNKFYTP-TADGCGS--LGLR 106
            |.:|:...|:.::    :|  |.|:|     |.|..|           |.| ..:||||  ||::
  Rat    43 FESVNSYVDSFMELLGGKNGVCQYRCRYGKAPMPRPG-----------YKPQEPNGCGSYFLGIK 96

  Fly   107 I--STDY-LPAKEMETCCNDHDICYDTCNSDKELCDLDFKRCLYKYCDSYEKSIA-SDLMMKGCK 167
            :  |.|. :||  |..|||..|:|||||.::|..||..|:.||:..|...::|:. ...:...|.
  Rat    97 VPGSMDLGIPA--MTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEAACD 159

  Fly   168 AAAKMLFTGTLTLGCRSYLDSQQRSCYCA 196
            :.|..:|....|||||.:::||:.:|.||
  Rat   160 SLADTVFNTVWTLGCRPFMNSQRAACICA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GXIVsPLA2NP_001261903.1 Phospholip_A2_3 18..199 CDD:421899 53/159 (33%)
Pla2g12bXP_346132.5 PLA2G12 18..195 CDD:284389 53/159 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351571
Domainoid 1 1.000 91 1.000 Domainoid score I7516
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5013
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299904at2759
OrthoFinder 1 1.000 - - FOG0003743
OrthoInspector 1 1.000 - - otm46405
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12824
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2603
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.