powered by:
Protein Alignment GXIVsPLA2 and F44B9.10
DIOPT Version :9
Sequence 1: | NP_001261903.1 |
Gene: | GXIVsPLA2 / 39734 |
FlyBaseID: | FBgn0036545 |
Length: | 230 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_741239.1 |
Gene: | F44B9.10 / 259518 |
WormBaseID: | WBGene00018411 |
Length: | 117 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 19/63 - (30%) |
Similarity: | 26/63 - (41%) |
Gaps: | 10/63 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 CGSLGLRISTDYLPAK-----EMETCCNDHDICYDTCNSDKELCDLDFKRCL-----YKYCDS 152
|||..:..|..|..:. ::..||..||:||..|...:..||..|..|| ..:|.|
Worm 32 CGSGSISTSISYTSSYFCDQIQLNQCCMYHDLCYAGCTLPQMECDNQFCECLATIISNPFCQS 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160165655 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1299904at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003743 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12824 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.040 |
|
Return to query results.
Submit another query.