DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GXIVsPLA2 and F44B9.10

DIOPT Version :9

Sequence 1:NP_001261903.1 Gene:GXIVsPLA2 / 39734 FlyBaseID:FBgn0036545 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_741239.1 Gene:F44B9.10 / 259518 WormBaseID:WBGene00018411 Length:117 Species:Caenorhabditis elegans


Alignment Length:63 Identity:19/63 - (30%)
Similarity:26/63 - (41%) Gaps:10/63 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 CGSLGLRISTDYLPAK-----EMETCCNDHDICYDTCNSDKELCDLDFKRCL-----YKYCDS 152
            |||..:..|..|..:.     ::..||..||:||..|...:..||..|..||     ..:|.|
 Worm    32 CGSGSISTSISYTSSYFCDQIQLNQCCMYHDLCYAGCTLPQMECDNQFCECLATIISNPFCQS 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GXIVsPLA2NP_001261903.1 Phospholip_A2_3 18..199 CDD:421899 19/63 (30%)
F44B9.10NP_741239.1 PLA2G12 <54..>89 CDD:284389 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1299904at2759
OrthoFinder 1 1.000 - - FOG0003743
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12824
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.