DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GXIVsPLA2 and C31H1.5

DIOPT Version :9

Sequence 1:NP_001261903.1 Gene:GXIVsPLA2 / 39734 FlyBaseID:FBgn0036545 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_500864.2 Gene:C31H1.5 / 183097 WormBaseID:WBGene00016288 Length:315 Species:Caenorhabditis elegans


Alignment Length:88 Identity:26/88 - (29%)
Similarity:34/88 - (38%) Gaps:18/88 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PTADGCGS--LGLRISTDYL------PAKEMETCCNDHDICYDTCNSDKELCDLDFKRCL----- 146
            |.|..||:  ...:||.:.:      .|.|:..||..||.|||.....:|.||..|..||     
 Worm    39 PEAWFCGASRFQWKISHEVISQTCDEKAIELNHCCAVHDSCYDNIAQTQEGCDNKFCNCLRNAMT 103

  Fly   147 -----YKYCDSYEKSIASDLMMK 164
                 |..|..:....|..|:.|
 Worm   104 STKDRYFMCADFVTDAACSLVRK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GXIVsPLA2NP_001261903.1 Phospholip_A2_3 18..199 CDD:421899 26/88 (30%)
C31H1.5NP_500864.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D541846at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12824
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.