DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C3 and Pka-C2

DIOPT Version :9

Sequence 1:NP_730083.2 Gene:Pka-C3 / 39733 FlyBaseID:FBgn0000489 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster


Alignment Length:315 Identity:129/315 - (40%)
Similarity:199/315 - (63%) Gaps:4/315 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 ESEESSSVQTAKGVRKYHLDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIE 317
            |.||..:.||.....  :|::|.....:|.|:||.|.|.|::..:.|.|.|:::..:::||||:.
  Fly    26 EFEERWNHQTQSPYT--NLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLVRLKQVA 88

  Fly   318 HVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIV 382
            ||.||:::|...|.||:|.|..|||....||:|...|.|||||:|.|...||..:.:.||||::.
  Fly    89 HVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAAQVA 153

  Fly   383 SALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHN 447
            .||||:|.:.::||||||||:|:::.|::|||||||.|::..||.||||||||:||||:|.:.:|
  Fly   154 LALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYN 218

  Fly   448 KAVDWWALGVLIYEMLVGYPPF--YDEQPFGIYEKILSGKIEWERHMDPIAKDLIKKLLVNDRTK 510
            |:|||||.|:|:||.:.|..||  ::.....:|.||.....:...:.....:.|::.|:..|.:|
  Fly   219 KSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYFTSQLRSLVESLMQVDTSK 283

  Fly   511 RLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEKD 565
            ||||..:|:.|||.|.||:.::|..:.::::..|..|.:....|..||:::..||
  Fly   284 RLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C3NP_730083.2 PTZ00263 262..583 CDD:140289 125/306 (41%)
STKc_PRKX_like 272..563 CDD:270763 121/292 (41%)
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 121/290 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440853
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.