DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C3 and Pka-C1

DIOPT Version :9

Sequence 1:NP_730083.2 Gene:Pka-C3 / 39733 FlyBaseID:FBgn0000489 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster


Alignment Length:344 Identity:176/344 - (51%)
Similarity:243/344 - (70%) Gaps:9/344 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 GNGRDADDATHDSSESIEEDDGNETDDEEDDDESEESSSVQTAKGVRKYHLDDYQIIKTVGTGTF 285
            ||.....:...|::|:::|  ..|...||.:|:...:.:...|       |||::.|||:|||:|
  Fly     2 GNNATTSNKKVDAAETVKE--FLEQAKEEFEDKWRRNPTNTAA-------LDDFERIKTLGTGSF 57

  Fly   286 GRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMI 350
            |||.:.:.:.::.|.|||||...:|::|||:||..||:.||:.|:.||::||.:..||:|||||:
  Fly    58 GRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMV 122

  Fly   351 FDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITD 415
            .:||.|||:|::||..|:|:...|.||||:||.|.||||.|.::|||||||||||:..|:||:||
  Fly   123 LEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTD 187

  Fly   416 FGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEK 480
            |||||:::.|||||||||||:|||||.|||:||||||||||||:|||..|||||:.:||..||||
  Fly   188 FGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEK 252

  Fly   481 ILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPI 545
            |:|||:.:..|.....|||::.||..|.|||.||:|.|.:|:|..:||...:|..::.||::.|.
  Fly   253 IVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPF 317

  Fly   546 LPDVHHDGDTKNFDDYPEK 564
            :|.....|||.|||||.|:
  Fly   318 IPRCKGPGDTSNFDDYEEE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C3NP_730083.2 PTZ00263 262..583 CDD:140289 167/303 (55%)
STKc_PRKX_like 272..563 CDD:270763 164/290 (57%)
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 162/288 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440856
Domainoid 1 1.000 300 1.000 Domainoid score I258
eggNOG 1 0.900 - - E1_KOG0616
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 333 1.000 Inparanoid score I510
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 1 1.000 - - FOG0000539
OrthoInspector 1 1.000 - - mtm9237
orthoMCL 1 0.900 - - OOG6_100326
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.