DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and NUAK1

DIOPT Version :10

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_055655.1 Gene:NUAK1 / 9891 HGNCID:14311 Length:661 Species:Homo sapiens


Alignment Length:51 Identity:12/51 - (23%)
Similarity:25/51 - (49%) Gaps:3/51 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 APNMSQMADPLTALMYAVQVMKLLKSLTEKTVRERE---ASSSVVDRRCSK 241
            |.|.:|:..|.......::.::.|:.||::.:::.|   ..|..|:..|.|
Human   297 AQNQNQVRSPGGPGPLTLKEVEELEQLTQQLMQDMEHPQRQSVAVNESCGK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 12/51 (24%)
UBA_BRSK 298..350 CDD:270525
NUAK1NP_055655.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
STKc_NUAK 53..306 CDD:270975 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 345..421 2/3 (67%)
GILK motif 399..402
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..570
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.