DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and SnRK1.3

DIOPT Version :9

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_198760.1 Gene:SnRK1.3 / 833940 AraportID:AT5G39440 Length:494 Species:Arabidopsis thaliana


Alignment Length:433 Identity:154/433 - (35%)
Similarity:240/433 - (55%) Gaps:52/433 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YRLEKTLGKGQTGLVKLGVHCVIGKKVAIKIINREKLSE-SVLMKVEREIAIMKLIDHPHVLGLS 81
            ||:.||||.|....|||.:|...|.||||||:||.|:.. .:.:||:|||.|::.:.|||::...
plant    19 YRIGKTLGHGSFAKVKLALHVATGHKVAIKILNRSKIKNMGIEIKVQREIKILRFLMHPHIIRQY 83

  Fly    82 DVYENKKYLYLILEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENL 146
            :|.|....:|:::|:|..||||||:|:||:|...|||..|:||||.:::||.:.|.||||||||:
plant    84 EVIETPNDIYVVMEYVKSGELFDYIVEKGKLQEDEARHLFQQIISGVEYCHRNMIVHRDLKPENV 148

  Fly   147 LLDEKNNIKIADFGMASLQPAGSMLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILYALLVG 211
            |||.:.||||.|||::::...|..|:||||||:||.||||.|:.| |...|:|||||||||||.|
plant   149 LLDSQCNIKIVDFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKPY-GPDVDIWSCGVILYALLCG 212

  Fly   212 ALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQSLLRGMIEVNPDRRLTLAEINRHPWVTAGGKGE 276
            .|||||:|:..:.||:|||::.:|:.:....:.|:..|:.|:|..|:::.||.:|||.  .....
plant   213 TLPFDDENIPNVFEKIKRGMYTLPNHLSHFARDLIPRMLMVDPTMRISITEIRQHPWF--NNHLP 275

  Fly   277 LELELPMMEVVQTHVIPTATAVDPDVLNAICSLGCFKEKEKLIQELLSSSHNTEKVIYFLLLERK 341
            |.|.:|.::     .|..|..::.:::..:.::|.  ::..::..|.:...|...|.|.|:|:.:
plant   276 LYLSIPPLD-----TIDQAKKIEEEIIQNVVNIGF--DRNHVVDSLANRIQNEATVAYHLILDNR 333

  Fly   342 RRRPALEDDDEIAQKSRSELDAV---DPPRKRLDTCRINGTNAPSY--------------GQISE 389
            .:...  .:|....|.:...|.:   ..|.:.: |..:..:.:..|              |..|:
plant   334 NQNSV--PNDPFQSKFKEISDGIFNSTLPVQNI-TSHVGHSFSALYGLKSNVKDDKTWTLGLQSQ 395

  Fly   390 GSPLTPRRQAFN---------------------FRSYSSTRNH 411
            |||.....:.|.                     .||::..:||
plant   396 GSPYDIMTEIFKALQNLKICWKKIGLYNIKCRWVRSFAYYKNH 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 125/251 (50%)
S_TKc 18..269 CDD:214567 125/251 (50%)
UBA_BRSK 298..350 CDD:270525 7/51 (14%)
SnRK1.3NP_198760.1 STKc_AMPK_alpha 16..270 CDD:270981 125/251 (50%)
UBA_SnRK1_plant 292..332 CDD:270520 7/41 (17%)
AMPKA_C 388..491 CDD:213378 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100252
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.