DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and si:dkey-265c15.9

DIOPT Version :9

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_017214435.1 Gene:si:dkey-265c15.9 / 798758 ZFINID:ZDB-GENE-081028-10 Length:508 Species:Danio rerio


Alignment Length:271 Identity:72/271 - (26%)
Similarity:124/271 - (45%) Gaps:37/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YRLEKTLGKGQTGLVKLGVHCVIGKKVAIKII----NREKLSESVLMKVEREIAIMKLIDH---- 74
            |:|.|.||:|..|.|..|:....|.:||:|.:    |.:.:|.|....:..||.:..:...    
Zfish   250 YKLGKQLGEGGFGSVYEGIRIQDGLQVAVKFVQKTPNMQDVSSSCDQPLPLEITLANMASGGSRC 314

  Fly    75 PHVLGLSDVYENKKYLYLILEHVSGG-ELFDYL-VKKGRLTPKEARKFFRQIISALDFCHSHSIC 137
            |:::.|.|....|.:..:::|..|.. :|..:| |..|.|:.|.|....||.:.|.:.|....:.
Zfish   315 PNIIKLLDWQVFKNHYVMVMERPSPSMDLEAFLEVSGGVLSEKTAHTIMRQAVYAANVCCYRGVF 379

  Fly   138 HRDLKPENLLLD-EKNNIKIADFGMASLQPAGSMLETS----CGSPHYACPEVIRGEKYDGRKAD 197
            |||:|.:|||:: :...:|:.|||....     |:|::    .|:..|..||......|..:.|.
Zfish   380 HRDIKLQNLLVNPDTLEVKLIDFGCGDF-----MMESAYSLFSGTEAYIPPEFYEKGCYRAKPAT 439

  Fly   198 VWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPH-----FVPPDCQSLLRGMIEVNPDRR 257
            |:|.||:|:.:|.|..|...|            ::::.|     .:..:|..::...:..||:.|
Zfish   440 VYSLGVLLFTMLHGEFPSAYD------------LYYLQHDWSKFTLSQECCDMMTACLHENPECR 492

  Fly   258 LTLAEINRHPW 268
            :.|.|:..|.|
Zfish   493 IPLEEMPYHDW 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 72/271 (27%)
S_TKc 18..269 CDD:214567 72/271 (27%)
UBA_BRSK 298..350 CDD:270525
si:dkey-265c15.9XP_017214435.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.