DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and pimr110

DIOPT Version :9

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001082859.1 Gene:pimr110 / 561422 ZFINID:ZDB-GENE-041014-282 Length:514 Species:Danio rerio


Alignment Length:281 Identity:85/281 - (30%)
Similarity:127/281 - (45%) Gaps:29/281 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KENNVTAENCQFVGPYRLEKTLGKGQTGLVKLGVHCVIGKKVAIKIINREKLSESVLMKVE---- 63
            ||..:...|.|   .|.:...|.||..|.|..|.....|.:||:|:.|.:|   ..|:.|:    
Zfish   241 KETQIIEINSQ---GYEIGAELDKGGCGTVYEGSRLEDGLQVAVKVSNFKK---KQLISVDGFDE 299

  Fly    64 ---REIAIMKLIDH----PHVLGLSDVYENKKYLYLILEH-VSGGELFDYLVK-KGRLTPKEARK 119
               .|||:..|.:.    ..::.|.|......:.:::||. :....|||:|.| :|.|...:.||
Zfish   300 PLPLEIALHFLANKGPKVKEIIELLDWKVEADHYFMVLERPIPCVSLFDFLSKHRGILPEDKLRK 364

  Fly   120 FFRQIISALDFCHSHSICHRDLKPENLLLD-EKNNIKIADFGMASLQPAGSMLETSCGSPHYACP 183
            ...|.|.|...|....:.|||:|.||||:: :...:|:.|||...|.......|.. |:..:|.|
Zfish   365 IMLQTIIAAQTCCQRGVLHRDIKLENLLINPDTLEVKLIDFGCGDLLTEDIYKEFR-GTREFAPP 428

  Fly   184 EVIRGEKYDGRKADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIP-HFVPPDCQSLLR 247
            |..|..:|.|..|.|||.||:|:.::....|...|     |.||...  ||| :.:..:|.....
Zfish   429 EFWRIGRYRGEPATVWSLGVVLFLMIFCRYPGKAD-----LPKVNNK--HIPINGLSKECCDFFH 486

  Fly   248 GMIEVNPDRRLTLAEINRHPW 268
            |.:::|...||.|.::|.|.|
Zfish   487 GCLQLNQMDRLNLQKLNSHEW 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 81/268 (30%)
S_TKc 18..269 CDD:214567 81/266 (30%)
UBA_BRSK 298..350 CDD:270525
pimr110NP_001082859.1 PKc_like 253..508 CDD:304357 81/266 (30%)
S_TKc 253..508 CDD:214567 81/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.