DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and CG17698

DIOPT Version :9

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster


Alignment Length:332 Identity:103/332 - (31%)
Similarity:167/332 - (50%) Gaps:49/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YRLEKTLGKGQTGLVKLGVHCVIGKKVAIKIINREKL-------------SESVLMKVEREIAIM 69
            |||.:.:|:|..|||||..........|:||:::::|             :.|.|.:|.||||::
  Fly   283 YRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMRRGPRKATSPLDRVYREIAVL 347

  Fly    70 KLIDHPHVLGLSDVYEN--KKYLYLILEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDF-- 130
            |.:|||:|:.|.:|.::  :..||::.|.|..||:. .:.....|:.|.|...||:.:..|::  
  Fly   348 KKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVL-RIPTDNPLSEKRAWSIFRESLLGLEYYT 411

  Fly   131 ----------------CHSHSICHRDLKPENLLLDEKNNIKIADFGMASL---QPAGSMLETSCG 176
                            .|...|.|.|:||.||||.|..::||||.|:.:.   ..|.....::.|
  Fly   412 MLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAG 476

  Fly   177 SPHYACPE-VIRGE-KYDGRKADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIP--HF 237
            :|.:..|| :|.|: :|.||.||||:.|..||:|:.|.:||..|::..|.||:|:.....|  |.
  Fly   477 TPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENHK 541

  Fly   238 VPPDCQSLLRGMIEVNPDRRLTLAEINRHPWVTAGGKGELELELPMMEVVQTHVIPTATAVDPDV 302
            |..:.:|.:..|:|.||.:|:|:.::....|||:.|...|..|.....:||..        |.|:
  Fly   542 VTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLPTEEENCCLVQVD--------DEDI 598

  Fly   303 LNAICSL 309
            .:.:.|:
  Fly   599 DSVVRSI 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 92/290 (32%)
S_TKc 18..269 CDD:214567 92/290 (32%)
UBA_BRSK 298..350 CDD:270525 3/12 (25%)
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 92/290 (32%)
STKc_CAMKK 288..574 CDD:271020 90/286 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.