DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and CG10177

DIOPT Version :9

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:238 Identity:71/238 - (29%)
Similarity:124/238 - (52%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KVAIKIINREKLSE---SVLMKVEREIAIMKLIDHPHVLGLSDVYENKKYLYLILEHVSGGELFD 104
            |..:|::|::..|.   ...|:.|   .:.:|..||:::.|....|:::|:|.:|||:. ..:..
  Fly   174 KCTVKMVNKQTQSNDRGDTYMEAE---VLRQLQSHPNIIELMYTVEDERYMYTVLEHLD-CNMQK 234

  Fly   105 YLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDEKNN------IKIADFGMAS 163
            .:.|:|.|:..:||...|..:|||...|...:.|||:||||||:...:.      :|:|:|.:|:
  Fly   235 VIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLAT 299

  Fly   164 LQPAGSMLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILYALLVGALPFDD--DNLRQLLEK 226
            .. .||.|...||:|.|..||:|....|| .:.|.||.||.|:.:|.|.:||..  .|.:::...
  Fly   300 YY-RGSKLYVRCGTPCYMAPEMIAMSGYD-YQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAA 362

  Fly   227 VKRGVFHIP----HFVPPDCQSLLRGMIEVNPDRRLTLAEINR 265
            :..|....|    ..:.|:...|:.|::..:|..|:.:||:::
  Fly   363 IMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 71/238 (30%)
S_TKc 18..269 CDD:214567 71/238 (30%)
UBA_BRSK 298..350 CDD:270525
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 71/238 (30%)
PKc_like 164..403 CDD:304357 70/234 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.