DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and PASK

DIOPT Version :10

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001239048.1 Gene:PASK / 23178 HGNCID:17270 Length:1330 Species:Homo sapiens


Alignment Length:267 Identity:91/267 - (34%)
Similarity:140/267 - (52%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YRLEKTLGKGQTGLVKLGVHCVIGKKVAIKIINREKLSESV------LMKVEREIAIMKLIDHPH 76
            |.....||.|..|.|...|.....|:|.:|.|.:||:.|..      |.||..||||:..::|.:
Human   999 YSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHAN 1063

  Fly    77 VLGLSDVYENKKYLYLILE-HVSGGELFDYLVKKGRLTPKEARKFFRQI-------ISALDFCHS 133
            ::.:.|::||:.:..|::| |.||.:||.::.:..||....|...|||:       :||:.:...
Human  1064 IIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQVRAGQSRLVSAVGYLRL 1128

  Fly   134 HSICHRDLKPENLLLDEKNNIKIADFGMASLQPAGSMLETSCGSPHYACPEVIRGEKYDGRKADV 198
            ..|.|||:|.||:::.|...||:.|||.|:....|.:..|.||:..|..|||:.|..|.|.:.::
Human  1129 KDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEM 1193

  Fly   199 WSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQSLLRGMIEVNPDRRLTLAEI 263
            ||.||.||.|:....||.:      ||:......|.|:.|..:..||:.|:::..|:||.||.::
Human  1194 WSLGVTLYTLVFEENPFCE------LEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKL 1252

  Fly   264 NRHPWVT 270
            ...||||
Human  1253 VTDPWVT 1259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 88/264 (33%)
UBA_BRSK 298..350 CDD:270525
PASKNP_001239048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..47
PAS 133..232 CDD:238075
PAS 344..401 CDD:214512
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 837..857
STKc_PASK 998..1258 CDD:270906 88/264 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1305..1330
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.