DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and PIM2

DIOPT Version :9

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_006866.2 Gene:PIM2 / 11040 HGNCID:8987 Length:311 Species:Homo sapiens


Alignment Length:273 Identity:95/273 - (34%)
Similarity:144/273 - (52%) Gaps:31/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FVGPYRLEKTLGKGQTGLVKLGVHCVIGKKVAIKIINREK------LSESVLMKVEREIAIMKLI 72
            |...|||...||||..|.|..|.......:||||:|.|.:      ||:||...:  |:|::..:
Human    28 FEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLSDSVTCPL--EVALLWKV 90

  Fly    73 ----DHPHVLGLSDVYENKKYLYLILEH-VSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCH 132
                .||.|:.|.|.:|.::...|:||. :...:||||:.:||.|....:|.||.|:::|:..||
Human    91 GAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCH 155

  Fly   133 SHSICHRDLKPENLLLD-EKNNIKIADFGMASLQPAGSMLETS-----CGSPHYACPEVIRGEKY 191
            |..:.|||:|.||:|:| .:...|:.|||      :|::|...     .|:..|:.||.|...:|
Human   156 SRGVVHRDIKDENILIDLRRGCAKLIDFG------SGALLHDEPYTDFDGTRVYSPPEWISRHQY 214

  Fly   192 DGRKADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQSLLRGMIEVNPDR 256
            ....|.|||.|::||.::.|.:||:.|  :::||    ...|.|..|.|||.:|:|..:...|..
Human   215 HALPATVWSLGILLYDMVCGDIPFERD--QEILE----AELHFPAHVSPDCCALIRRCLAPKPSS 273

  Fly   257 RLTLAEINRHPWV 269
            |.:|.||...||:
Human   274 RPSLEEILLDPWM 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 93/269 (35%)
S_TKc 18..269 CDD:214567 93/267 (35%)
UBA_BRSK 298..350 CDD:270525
PIM2NP_006866.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
STKc_PIM2 31..287 CDD:271003 94/270 (35%)
S_TKc 32..286 CDD:214567 93/267 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.