DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and LOC100150106

DIOPT Version :9

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_001920484.7 Gene:LOC100150106 / 100150106 -ID:- Length:220 Species:Danio rerio


Alignment Length:208 Identity:58/208 - (27%)
Similarity:95/208 - (45%) Gaps:13/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IAIMKLIDHPHVLGLSDVYENKKYLYLILEHVSGGE-LFDYLVKKGRLTPKEARKFFRQIISALD 129
            :.:||....|:::.|.:..|.:....||||:....: |..|:.....:...:||:..||:|.|:.
Zfish     3 LRLMKAPRCPNIIRLHNWLEIEDNCVLILEYAESCQTLLQYIKDTADIEENQARQLMRQLIRAIM 67

  Fly   130 FCHSHSICHRDLKPENLLLD-EKNNIKIADFGMASLQPAGSMLETSC---GSPHYACPEVIRGEK 190
            ||....:.|.|:...|:|:. .:..:|:.|||.|  ||.........   |:.|...||.:|...
Zfish    68 FCTERGVFHGDIHTANILVTLPRLELKLIDFGCA--QPITQKPFNKSDYRGAGHGMPPEALRCRV 130

  Fly   191 YDGRKADVWSCGVILYALLVGALPFDDDNLRQLLEKVKRGVFHIPHFVPPDCQSLLRGMIEVNPD 255
            :....|.||:.|::||.::.|.|.|   |.||   .:..|...|...:...|..|:...:..||.
Zfish   131 FHANPAYVWTIGIMLYEIMHGRLAF---NNRQ---SIMFGAIQIHPRLSTACVDLISQCLIRNPA 189

  Fly   256 RRLTLAEINRHPW 268
            :||.|.::..|.|
Zfish   190 KRLQLHQVEEHCW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 58/208 (28%)
S_TKc 18..269 CDD:214567 58/208 (28%)
UBA_BRSK 298..350 CDD:270525
LOC100150106XP_001920484.7 PKc_like <1..203 CDD:328722 58/208 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.