DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sff and si:dkeyp-34c12.4

DIOPT Version :9

Sequence 1:NP_648814.3 Gene:sff / 39732 FlyBaseID:FBgn0036544 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_009294724.3 Gene:si:dkeyp-34c12.4 / 100034438 ZFINID:ZDB-GENE-050208-533 Length:597 Species:Danio rerio


Alignment Length:292 Identity:78/292 - (26%)
Similarity:137/292 - (46%) Gaps:44/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QKENN--VTAE---NCQFVGPYRLEKTLGKGQTGLVKLGVHCVIGKKVAIKIINREKLSESVLMK 61
            |.|||  :|::   :|.    |.::..||:|..|.|..|.......|||:|.:.:.:..|.:.:.
Zfish   317 QIENNGKMTSQVINSCH----YLIDDMLGEGSFGTVYKGRRLHDDLKVAVKFVTKTEDVEYIRIS 377

  Fly    62 -----VEREIAIMKLIDH-----PHVLGLSDVYENKKYLYLILEHVSGGE-LFDYLVK-KGRLTP 114
                 ...|:|:: ::.|     |.::.|.|..:.:.:..::||:.|..| |:.:... .|.::.
Zfish   378 GHSEPFPLEVALL-ILAHGVSSVPEIIQLLDWQDQEDHYIMVLEYPSPCEDLYAFTESYGGSISE 441

  Fly   115 KEARKFFRQIISALDFCHSHSICHRDLKPENLLLD-EKNNIKIADFGMASLQPAGSML-----ET 173
            ..||...:|...|...|..:.:.|||:|.||||:: |.:.:|:.|||      .|.:|     :|
Zfish   442 GLARVVMQQATQAAYMCCRNGVLHRDIKLENLLINKETHKVKLIDFG------CGDLLKKLPYDT 500

  Fly   174 SCGSPHYACPEVIRGEKYDGRKADVWSCGVILYALLVGALPFDDDNLRQLLEK--VKRGVFHIPH 236
            ..|:..|..||.....:|:|:.|.|||.|::|:.|:....| :...|..:.|.  .|.|      
Zfish   501 FAGTLEYCPPEFEETGEYNGKPATVWSLGILLFVLVCEDFP-NPQELHMINENNFSKAG------ 558

  Fly   237 FVPPDCQSLLRGMIEVNPDRRLTLAEINRHPW 268
             :..:|..|:...::..|::|:.|.||..|.|
Zfish   559 -LSDECCQLISCCLQQKPEQRIQLKEILLHEW 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sffNP_648814.3 STKc_BRSK1_2 16..269 CDD:270983 72/273 (26%)
S_TKc 18..269 CDD:214567 72/271 (27%)
UBA_BRSK 298..350 CDD:270525
si:dkeyp-34c12.4XP_009294724.3 STKc_PIM 333..590 CDD:270907 72/276 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.