Sequence 1: | NP_648814.3 | Gene: | sff / 39732 | FlyBaseID: | FBgn0036544 | Length: | 861 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017212812.1 | Gene: | pimr50 / 100006144 | ZFINID: | ZDB-GENE-070912-463 | Length: | 321 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 69/207 - (33%) |
---|---|---|---|
Similarity: | 107/207 - (51%) | Gaps: | 21/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 LGKGQTGLVKLGVHCVIGKKVAIKIINRE----KLSESVLMKVEREIAIMKLIDH----PHVLGL 80
Fly 81 SDVYENKKYLYLILEHVSG-GELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPE 144
Fly 145 NLLLD-EKNNIKIADFGMASLQPAGSMLETS-----CGSPHYACPEVIRGEKYDGRKADVWSCGV 203
Fly 204 ILYALLVGALPF 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sff | NP_648814.3 | STKc_BRSK1_2 | 16..269 | CDD:270983 | 69/207 (33%) |
S_TKc | 18..269 | CDD:214567 | 69/207 (33%) | ||
UBA_BRSK | 298..350 | CDD:270525 | |||
pimr50 | XP_017212812.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |