DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and NtR

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster


Alignment Length:399 Identity:83/399 - (20%)
Similarity:159/399 - (39%) Gaps:71/399 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LDKHP--IHGIDWSKFDESSS-----------DKEILDLLLEKKRYDKRLLPPVNDEDFCCGLQS 369
            :|:.|  |:.:.:|.|..:::           ..||..::.|:.:.:| ||..:|       :|:
  Fly   171 IDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEK-LLSHLN-------IQA 227

  Fly   370 PDMATNQNARRPHNRGTLTVNVNVLLLSLASPDESSLKYEVEFLLNQQWNDPRLQYGNKSHYDFL 434
                  :||..|.|..:::.:...  .|||....||| .:....:...|.|.||.: ....:..|
  Fly   228 ------ENASMPANLSSISFHFQT--RSLAYEQTSSL-LQTRMHMMMHWRDSRLVW-KPEDFGSL 282

  Fly   435 NALHHHD-SIWTPDTYFIMHGDFKD-PIIPMHFALRIFRNGTIT-YAMRRHLILSCQGSLHIFPF 496
            .:..|.| .||.|... :::|..:. ..:...:.|.::.||:|| ||....|...|..|...:|.
  Fly   283 ESFEHPDLRIWKPHMN-VLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPS 346

  Fly   497 DDPKCSFSM--------ESIS--YEEAQIKYVWKNDEDTLRKSPSLTTLNAYLIKN--QTTACDQ 549
            :...|...:        |:::  |:: |.|.:..|:........|.|.::..|::|  |.....:
  Fly   347 ERVTCDIELGLNGQEGQENVALIYDD-QRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPK 410

  Fly   550 NSWRGNYSCLQVELTFTRDRAYYFTTVFIPGIILVTSSFITFWLEWNAVPARVMIGVTTM---LN 611
            ...:.....:.:|.|..|:|::|.|..::|.|.......::|.|......:.::|.:...   |.
  Fly   411 GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLM 475

  Fly   612 FFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYVGRKRPLHNVVYRPGENPVTQ 676
            :.|.   :.|...|...:||..|   :.|...|..:|. :|:.::.        :|     |...
  Fly   476 YMTR---YASPHYVPPMMTAYKV---IMMTTTYCYILH-ICIIWLD--------LY-----PPRS 520

  Fly   677 RLPAVLSRI 685
            :.|..|.|:
  Fly   521 KAPGWLVRV 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 53/242 (22%)
Neur_chan_memb 578..>682 CDD:280999 19/106 (18%)
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/19 (26%)
Neur_chan_LBD 212..429 CDD:280998 51/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.