DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and gabra6a

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_005173169.1 Gene:gabra6a / 393704 ZFINID:ZDB-GENE-040426-1692 Length:435 Species:Danio rerio


Alignment Length:449 Identity:124/449 - (27%)
Similarity:186/449 - (41%) Gaps:81/449 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 LMLCYLTTASTAAATQSETGALDKHPIHGIDWSKFDESSSDKEILDLLLEKKRYDKRLLPPVNDE 361
            |:|.:|...|.       |..:.|..|:         |.:...|||.|||  .||.||       
Zfish     3 LLLAFLCLTSV-------TNVIGKQKIN---------SENITRILDGLLE--GYDNRL------- 42

  Fly   362 DFCCGLQSPDMATNQNARRPHNRGTLT-VNVNVLLLSLASPDESSLKYEVEFLLNQQWNDPRLQY 425
                              ||.:..::| |..::.:.|.....:.::::.::....|.|.|.||.:
Zfish    43 ------------------RPGSGVSVTEVKTDIFVTSFGPVSDVNMEFTMDMFFRQMWVDERLAF 89

  Fly   426 GNKSHYDFLNALHHHDSIWTPDTYF------IMHGDFKDPIIPMHFALRIFRNGTITYAMRRHLI 484
            ........||. ...|.||||||:|      :.| :...|    :...||.:|||:.|.||..:.
Zfish    90 QGPIEILPLNN-RMVDKIWTPDTFFRNARKSLAH-NMTSP----NKLFRIMQNGTVFYTMRLTVS 148

  Fly   485 LSCQGSLHIFPFDDPKCSFSMESISYEEAQIKYVW-KNDEDTLRKSPSLTTLNAYLIKNQTTACD 548
            ..|...|..||.|...|.....|.:|...:|.|.| |..|.::...|..::|..|.:..||...:
Zfish   149 AVCPMVLRDFPMDGHTCPLYFGSYAYTNREIVYTWRKGLEASVDFPPESSSLLQYDLLGQTLFTE 213

  Fly   549 QNSW-RGNYSCLQVELTFTRDRAYYFTTVFIPGIILVTSSFITFWLEWNAVPARVMIGVTTMLNF 612
            ...: .|.||...|.....|...|:....:||.|::|..|.::||:...:||||.:.|:||:|..
Zfish   214 TYKFSTGLYSVQVVHFYLQRKLGYHLIQTYIPLIMVVVLSQVSFWINKESVPARTVAGITTVLTM 278

  Fly   613 FTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYV--------GRKRPLHNVVYRP 669
            .|.|...||:||.||..|||:.:..||..|:.::|:||..|||.        ..|.|..::|...
Zfish   279 TTLSISARSSLPKVSYATAMDWFIAVCFAFVASALVEFAAVNYYATLEANRENHKLPRGSIVESQ 343

  Fly   670 G-------ENPVTQRLPAVLSRIGVILASPLASAAATPA-MSMMGGATP---MSSGTPA 717
            .       |:|.:........|.|.    |::.|..|.. :.:.|.|.|   |.:||.|
Zfish   344 AQGSDDEPESPQSDTSAYSRKRRGY----PVSEAPRTRVPIFLQGSAFPPNMMLAGTSA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 62/236 (26%)
Neur_chan_memb 578..>682 CDD:280999 40/118 (34%)
gabra6aXP_005173169.1 LIC 2..422 CDD:273305 124/449 (28%)
Neur_chan_LBD 28..234 CDD:280998 62/238 (26%)
Neur_chan_memb 242..419 CDD:280999 52/161 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.