DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and GLRA1

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001139512.1 Gene:GLRA1 / 2741 HGNCID:4326 Length:457 Species:Homo sapiens


Alignment Length:456 Identity:129/456 - (28%)
Similarity:206/456 - (45%) Gaps:89/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 STAAATQSETGALDKHPIHGIDWSKFDESSSDKEILDLLLEK-KRYDKRLLPPVNDEDFCCGLQS 369
            |.||:.::|.......|:            |..:.||.|:.: ..||.|:               
Human    19 SLAASKEAEAARSAPKPM------------SPSDFLDKLMGRTSGYDARI--------------- 56

  Fly   370 PDMATNQNARRPHNRG-TLTVNVNVLLLSLASPDESSLKYEVEFLLNQQWNDPRLQYGNKSHYDF 433
                      ||:.:| .:.|:.|:.:.|..|..|:::.|.|...|.||||||||.| |:...|.
Human    57 ----------RPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAY-NEYPDDS 110

  Fly   434 L----NALHHHDSIWTPDTYFIMH-GDFKDPIIPMHFALRIFRNGTITYAMRRHLILSCQGSLHI 493
            |    :.|   ||||.||.:|... |.....|...:..|||.|||.:.|::|..|.|:|...|..
Human   111 LDLDPSML---DSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKN 172

  Fly   494 FPFDDPKCSFSMESISYEEAQIKYVWKNDEDTLRKSPSLTTLNAYLIKNQTTA--CDQNSWRGNY 556
            ||.|...|...:||..|....:.:.|: ::..::.:..| ||..:::|.:...  |.::...|.:
Human   173 FPMDVQTCIMQLESFGYTMNDLIFEWQ-EQGAVQVADGL-TLPQFILKEEKDLRYCTKHYNTGKF 235

  Fly   557 SCLQVELTFTRDRAYYFTTVFIPGIILVTSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRS 621
            :|::......|...||...::||.:::|..|:|:||:..:|.||||.:|:||:|...|.|:|.|:
Human   236 TCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRA 300

  Fly   622 TLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYVGR---------------KRPLHNVVY--RP 669
            :||.||.:.|:::|..||:.|::::|||:..||:|.|               |.|:.|:..  ..
Human   301 SLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPMLNLFQEDEA 365

  Fly   670 GENPVTQRLPAVLSRIGVILASPLASAAATPAMSMMGGATPMSSGTPAASSSVATPGTPRITDPE 734
            ||....      .|..|:   .| |...|...:|:.|.....::..|.|.|.          .||
Human   366 GEGRFN------FSAYGM---GP-ACLQAKDGISVKGANNSNTTNPPPAPSK----------SPE 410

  Fly   735 E 735
            |
Human   411 E 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 66/236 (28%)
Neur_chan_memb 578..>682 CDD:280999 41/120 (34%)
GLRA1NP_001139512.1 LIC 7..446 CDD:273305 129/456 (28%)
Strychnine-binding. /evidence=ECO:0000250|UniProtKB:O93430 230..235 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..410 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614790at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.