DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and GABRA3

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_000799.1 Gene:GABRA3 / 2556 HGNCID:4077 Length:492 Species:Homo sapiens


Alignment Length:485 Identity:127/485 - (26%)
Similarity:196/485 - (40%) Gaps:97/485 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 CYLT-------------TASTAAATQSETGALDKHPIHGID---WSKFDESSSDK-----EILDL 343
            ||:|             |.....:.:.|.|...|..|.|:.   .....:.|:|.     .|||.
Human     9 CYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDR 73

  Fly   344 LLEKKRYDKRLLPPVNDEDFCCGLQSPDMATNQNARRPHNRGTLTVNVNVLLLSLASPDESSLKY 408
            ||:  .||.||.|.:.|                        ....|..::.:.|.....::.::|
Human    74 LLD--GYDNRLRPGLGD------------------------AVTEVKTDIYVTSFGPVSDTDMEY 112

  Fly   409 EVEFLLNQQWNDPRLQYGNKSHYDFLNALHHHDSIWTPDTYFIMHGDFKDPIIPM---HFALRIF 470
            .::....|.|:|.||::........||.| ....||||||:|  |...|.....|   :..||:.
Human   113 TIDVFFRQTWHDERLKFDGPMKILPLNNL-LASKIWTPDTFF--HNGKKSVAHNMTTPNKLLRLV 174

  Fly   471 RNGTITYAMRRHLILSCQGSLHIFPFDDPKCSFSMESISYEEAQIKYVWKNDEDTLRKSPSL--- 532
            .|||:.|.||..:...|...|..||.|...|.....|.:|..|::.|.|     ||.|:.|:   
Human   175 DNGTLLYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSW-----TLGKNKSVEVA 234

  Fly   533 ---TTLNAY----------LIKNQTTACDQNSWRGNYSCLQVELTFTRDRAYYFTTVFIPGIILV 584
               :.||.|          :|::.|         |.|..:.......|...|:....::|.|:.|
Human   235 QDGSRLNQYDLLGHVVGTEIIRSST---------GEYVVMTTHFHLKRKIGYFVIQTYLPCIMTV 290

  Fly   585 TSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLE 649
            ..|.::|||...:||||.:.||||:|...|.|...|::||.|:..|||:.:..||..|::::|:|
Human   291 ILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIE 355

  Fly   650 FVCVNYV--------GRKRPLHNVVYRPGENPVTQRLPAVLSRIGVILASPLASAAATPAMSMMG 706
            |..|||.        |:|.|....:.:.......::.....:.:|.  ..|:..|..|...::..
Human   356 FATVNYFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGT--TYPINLAKDTEFSTISK 418

  Fly   707 GATPMSSGTPAASSSVATPGTPRITD-PEE 735
            ||.|.:|.||   :.:|:|....:.| |.|
Human   419 GAAPSASSTP---TIIASPKATYVQDSPTE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 62/251 (25%)
Neur_chan_memb 578..>682 CDD:280999 37/111 (33%)
GABRA3NP_000799.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..54 5/25 (20%)
LIC 69..478 CDD:273305 116/425 (27%)
LGIC_ECD_GABAAR_A3 75..274 CDD:349837 58/241 (24%)
Cys-loop 191..205 CDD:349837 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.