DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and Gabrp

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_666129.1 Gene:Gabrp / 216643 MGIID:2387597 Length:440 Species:Mus musculus


Alignment Length:317 Identity:93/317 - (29%)
Similarity:158/317 - (49%) Gaps:21/317 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 LEKKRYDKRLLPPVNDEDFCCGLQSPDMATNQNARRPHNRGTLTVNVNVLLLSLASPDESSLKYE 409
            :|..|.||..||         |.::.....|:..|.......:.:.:.:.:.|::|..||::.|.
Mouse    28 VEVSRSDKLSLP---------GFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYT 83

  Fly   410 VEFLLNQQWNDPRLQY-GNKSHYDFLNALHHHDSIWTPDTYFI-MHGDFKDPIIPMHFALRIFRN 472
            ....|.|:|.||||.: ||||   |.......:.:|.||||.: ....|...:...:..:|:|.|
Mouse    84 ATIYLRQRWTDPRLVFEGNKS---FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSN 145

  Fly   473 GTITYAMRRHLILSCQGSLHIFPFDDPKCSFSMESISYEEAQIKYVWKNDEDTLRKSPSLTTLNA 537
            ||:.||:|....::|...|..:|.|...|...:||..|:...:::.|....|::|...:| .|..
Mouse   146 GTVLYALRITTTVTCNMDLSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENL-RLAQ 209

  Fly   538 YLIKNQ---TTACDQNSWRGNYSCLQVELTFTRDRAYYFTTVFIPGIILVTSSFITFWLEWNAVP 599
            |.|:..   .|...|.:  |||:.|.::....|:..|:....::|...||..|:::||:..::||
Mouse   210 YTIQQYFTLVTVSQQET--GNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVP 272

  Fly   600 ARVMIGVTTMLNFFTTSNGFRSTLPVVS-NLTAMNVWDGVCMCFIYASLLEFVCVNY 655
            ||..|||||:|:..|...|.|::||..: .:.|::|:.|:|..|::.:|||:...:|
Mouse   273 ARTCIGVTTVLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 61/225 (27%)
Neur_chan_memb 578..>682 CDD:280999 30/79 (38%)
GabrpNP_666129.1 Neur_chan_LBD 41..242 CDD:280998 55/206 (27%)
LIC 43..437 CDD:273305 86/293 (29%)
Neur_chan_memb 249..434 CDD:280999 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.