DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and lgc-52

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_502839.3 Gene:lgc-52 / 190669 WormBaseID:WBGene00013517 Length:423 Species:Caenorhabditis elegans


Alignment Length:394 Identity:98/394 - (24%)
Similarity:164/394 - (41%) Gaps:66/394 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 EDFCC---------GLQSPDMA----TNQNARRPHNRGTLTVNVNVLLLSLASPDESSLKYEVEF 412
            |||.|         |.::.|:|    ||.:.........:.|.|.:.:..::.....:..:.:::
 Worm    28 EDFTCDDIGLSSLSGAKATDLARILMTNYSRNALPEPAPVKVEVEITIQDISDISAITGTFTIDY 92

  Fly   413 LLNQQWNDPRLQYGNKSHYD--FLNALHHHD---SIWTPDTYFI------MHGDFKDPIIPMHFA 466
            .::..|||.||.:   ||.|  ..|....||   .:|:|:...:      :|...|..|:     
 Worm    93 WISAIWNDKRLAF---SHLDPCRKNLSLDHDMEPKLWSPNVCIVNSKSTKVHDSPKPNIL----- 149

  Fly   467 LRIFRNGTITYAMRRHLILSCQGSLHIFPFDDPKCSFSMESISYEEAQIKYVWKNDEDTLRKSPS 531
            |.||.||||....|......||.:|..||.|..:||...||.||..|.::..|      |..||.
 Worm   150 LMIFPNGTIWLNYRIRSEAPCQMNLRNFPLDSIRCSLVFESYSYNAADVELQW------LEWSPV 208

  Fly   532 LTTLNAYLIK----------NQTTACDQNSWRGNYSCLQVELTFTRDRAYYFTTVFIPGIILVTS 586
            .|..|.|.:.          :.|.|.....|..    |.|.:.|.|...:|...:::|..|.|..
 Worm   209 STVRNDYNLPDFRMTNITYGSVTEAYTAGMWHR----LSVSIHFERLYGFYILQMYLPTYISVFI 269

  Fly   587 SFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFV 651
            |:|.||::..|:|||:.:.|::::...........:||..|.:.|:::|...|:.||:.||:|..
 Worm   270 SWIAFWMDTKALPARITLSVSSLMALTFQFGNIVKSLPKASYVKAIDIWMFSCVGFIFFSLIELA 334

  Fly   652 CVNYVGRKRPLHNVVYRPGENPVTQRLPAVLSRIGVILASPLASAAATPAMSMMGGATPMSSGTP 716
            .|.|..:   :|:           |||..|...:|.:.::.:....:|...|.:..:...:.|:.
 Worm   335 IVAYNDK---MHD-----------QRLREVRCSVGNLNSNGIGQYNSTTRRSFVELSARRAKGSE 385

  Fly   717 AASS 720
            ..:|
 Worm   386 LGAS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 60/238 (25%)
Neur_chan_memb 578..>682 CDD:280999 29/103 (28%)
lgc-52NP_502839.3 Neur_chan_LBD 45..248 CDD:280998 55/220 (25%)
LIC 52..413 CDD:273305 91/370 (25%)
Neur_chan_memb 259..>338 CDD:280999 24/78 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.