DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and lgc-44

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_505954.2 Gene:lgc-44 / 179600 WormBaseID:WBGene00009790 Length:618 Species:Caenorhabditis elegans


Alignment Length:343 Identity:87/343 - (25%)
Similarity:154/343 - (44%) Gaps:53/343 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 GIDWSKFDESSSDKEILDLLLEKKRYDKRLLPPVNDEDFCCGLQSPDMATNQNARRPHNRGTLTV 389
            |:|:.:...||:   ||. .|.|..||.|..|.::.:|                       |:||
 Worm   238 GLDYQRPLPSST---ILP-FLRKMEYDARQPPSLHVDD-----------------------TVTV 275

  Fly   390 NVNVLLLSLASPDESSLKYEVEFLLNQQWNDPRLQYGNK-----SHYDFLNALHHHDSIWTPDTY 449
            .|.:.:.|:::.:.|::.|:::..:...|.||||::...     :.|.||..:...|.|:|...|
 Worm   276 KVGIAVQSMSNFELSTMDYDLDAWVRMSWIDPRLRHDLSRPILVNDYTFLKMIWRPDPIFTNSKY 340

  Fly   450 FIMHGDFKDPIIPMHFALRIFRNGTITYAMRRHL------ILSCQGSLHIFPFDDPKCSFSMESI 508
            ...|     .:..::|.|.||.:|.|...||.:|      |:.|:     :|.|:|..|..:.|:
 Worm   341 STFH-----KVTYLNFYLFIFPDGKIFMDMRVYLKPTAAQIVLCK-----YPHDNPAVSLKISSM 395

  Fly   509 SYEEAQIKYVW---KNDEDTLRKSPSLTTLNAYLIKNQTTACDQNSWRGNYSCLQVELTFTRDRA 570
            .:.:..:|..|   .||...:.|:..:..|:...:...|  |:.....|.||||:.:....|:..
 Worm   396 GFTQDVVKLEWFSDTNDAIWIEKNVKIPELSIRHLHPDT--CNGVRKSGVYSCLEAKFYMHREVG 458

  Fly   571 YYFTTVFIPGIILVTSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLTAMNVW 635
            |:....:||..|.|..|:|:.||....|..|:.:.:|..|.....:|..:..||.||.:.|:::|
 Worm   459 YHIANTYIPTAICVVFSWISVWLPEEFVEGRIFVSLTVFLTLSAENNSAKEELPKVSYVKAIDIW 523

  Fly   636 DGVCMCFIYASLLEFVCV 653
            .|....|::.::|:.:.|
 Worm   524 FGFTSTFVFLTMLQALVV 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 58/241 (24%)
Neur_chan_memb 578..>682 CDD:280999 23/76 (30%)
lgc-44NP_505954.2 Neur_chan_LBD 259..>417 CDD:280998 45/190 (24%)
Neur_chan_memb 464..>550 CDD:280999 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.