DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and lgc-34

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_493752.1 Gene:lgc-34 / 173443 WormBaseID:WBGene00020836 Length:390 Species:Caenorhabditis elegans


Alignment Length:367 Identity:81/367 - (22%)
Similarity:137/367 - (37%) Gaps:86/367 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 SDKEILDLLLEKKRYDKRLLPPVNDEDFCCGLQSPDMATNQNARRPHNRGTLTVNVNVLLLSLAS 400
            ::.:|:..:|.:  ||....|||.|.           |.|         ..:.|..|:.:..|..
 Worm    29 TEGQIVGRILSE--YDSSSRPPVRDH-----------ADN---------SAILVITNIFINRLIW 71

  Fly   401 PDESSLKYEVEFLLNQQWNDPRLQY--GNKSHYDFLNALHHHDSIWTPDTYFIMHGDFKDPIIPM 463
            .:..:   ||:..|.|||.|.||:|  ..:...|.:. |..:..||.|||||....:..      
 Worm    72 HNNYA---EVDLYLRQQWQDSRLKYDVDTREGIDEIR-LPGNRKIWEPDTYFTSGKELS------ 126

  Fly   464 HFALRIFRNGTITYAMRRHLILSCQGSLH---------------IFPFDDPK-CSFSMESISYEE 512
                |..:|.       :|:::...|.:.               :|||.:.: .:..:.|.:|:.
 Worm   127 ----RNEKNS-------KHIVVEPSGYIRSSERVLLELPYAYGTMFPFTNSRQFTIKLGSYNYDI 180

  Fly   513 AQIKYVWKNDEDTLRKSPSLTT---LNAYLIKNQTT-------ACDQNSWRGNYSCLQVELTFTR 567
            ..|.|:|.|       ||.|..   ::..|:|...|       .|..|...|.|||:...:.|:.
 Worm   181 DDIVYLWAN-------SPPLVNPIEVSQDLLKGDLTFEEASAGDCVGNYTVGVYSCIDAHVYFSA 238

  Fly   568 DRAYYFTTVFIPGIILVTSSFITFWL--EWNAVPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLT 630
            .......:.|:|.:.|:..|::.||:  .| :||..:...|.    ||..: .:...:...|...
 Worm   239 STISGLMSWFLPSLFLLIGSWLHFWIHGSW-SVPRTISAAVP----FFILA-AYYIFMREDSYTQ 297

  Fly   631 AMNVWDGVCMCFIYASLLEFVCVNYVGRKRPLHNVVYRPGEN 672
            |...|...|:...:.|.:|:..|...|.:|.:......|.|:
 Worm   298 AQGAWLAFCLVLTFFSFVEYFLVICCGGRRSIRYKTLGPQED 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 57/255 (22%)
Neur_chan_memb 578..>682 CDD:280999 22/97 (23%)
lgc-34NP_493752.1 LIC 1..388 CDD:273305 81/367 (22%)
LGIC_ECD_anion 58..237 CDD:349788 47/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614790at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.