DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and Glra1

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001277750.1 Gene:Glra1 / 14654 MGIID:95747 Length:457 Species:Mus musculus


Alignment Length:387 Identity:115/387 - (29%)
Similarity:191/387 - (49%) Gaps:60/387 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 YS-QSISFYAASSVLLMLCYLTTASTAAATQSETGALDKHPIHGIDWSKFDESSSDKEILDLLLE 346
            || .::.||...:::..       |.||:.::|.......|:            |..:.||.|:.
Mouse     2 YSFNTLRFYLWETIVFF-------SLAASKEAEAARSAPKPM------------SPSDFLDKLMG 47

  Fly   347 K-KRYDKRLLPPVNDEDFCCGLQSPDMATNQNARRPHNRG-TLTVNVNVLLLSLASPDESSLKYE 409
            : ..||.|:                         ||:.:| .:.|:.|:.:.|..|..|:::.|.
Mouse    48 RTSGYDARI-------------------------RPNFKGPPVNVSCNIFINSFGSIAETTMDYR 87

  Fly   410 VEFLLNQQWNDPRLQYGNKSHYDFL----NALHHHDSIWTPDTYFIMH-GDFKDPIIPMHFALRI 469
            |...|.||||||||.| |:...|.|    :.|   ||||.||.:|... |.....|...:..|||
Mouse    88 VNIFLRQQWNDPRLAY-NEYPDDSLDLDPSML---DSIWKPDLFFANEKGAHFHEITTDNKLLRI 148

  Fly   470 FRNGTITYAMRRHLILSCQGSLHIFPFDDPKCSFSMESISYEEAQIKYVWKNDEDTLRKSPSLTT 534
            .|||.:.|::|..|.|:|...|..||.|...|...:||..|....:.:.|: ::..::.:..| |
Mouse   149 SRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQ-EQGAVQVADGL-T 211

  Fly   535 LNAYLIKNQTTA--CDQNSWRGNYSCLQVELTFTRDRAYYFTTVFIPGIILVTSSFITFWLEWNA 597
            |..:::|.:...  |.::...|.::|::......|...||...::||.:::|..|:|:||:..:|
Mouse   212 LPQFILKEEKDLRYCTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDA 276

  Fly   598 VPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYVGRK 659
            .||||.:|:||:|...|.|:|.|::||.||.:.|:::|..||:.|::::|||:..||:|.|:
Mouse   277 APARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 66/236 (28%)
Neur_chan_memb 578..>682 CDD:280999 36/82 (44%)
Glra1NP_001277750.1 LIC 7..446 CDD:273305 113/382 (30%)
Strychnine-binding. /evidence=ECO:0000250|UniProtKB:O93430 230..235 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614790at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.