DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and Gabrg3

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_017177467.1 Gene:Gabrg3 / 14407 MGIID:95624 Length:468 Species:Mus musculus


Alignment Length:401 Identity:101/401 - (25%)
Similarity:170/401 - (42%) Gaps:100/401 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 ASSVLLMLCYLTTASTAAATQSETGALDKHPIHGIDWSKFDESSSDKEIL---------DLLLEK 347
            |:.:||:||..:.....:....|    |::.         |..|:.|.:|         .|:|.|
Mouse     2 AAKLLLLLCLFSGLHARSRRVEE----DENE---------DSPSNQKWVLAPKSQDTDVTLILNK 53

  Fly   348 --KRYDKRLLPPVNDEDFCCGLQSPDMATNQNARRPHNRGTLTVNVNVLLLSLASPDESSLKYEV 410
              :.|||:|.|.:       |::                 ...::|::.:.|:......:::|::
Mouse    54 LLREYDKKLRPDI-------GIK-----------------PTVIDVDIYVNSIGPVSSINMEYQI 94

  Fly   411 EFLLNQQWNDPRLQYGNKSHYDFLNALHHHDSIWTPDTYFIMHGDFKDPIIPMHF------ALRI 469
            :....|.|.|.||::.:......||: :....||.|||.|     ........|:      .|||
Mouse    95 DIFFAQTWTDSRLRFNSTMKILTLNS-NMVGLIWIPDTIF-----RNSKTAEAHWITTPNQLLRI 153

  Fly   470 FRNGTITYAMRRHLILSCQGSLHIFPFDDPKCSFSMESISYEEAQIKYVWKNDEDTLRKSPSLTT 534
            :.:|.|.|.:|..:...||..||.||.|...|..:..|..|.:.::.|.|:              
Mouse   154 WNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEMIYRWR-------------- 204

  Fly   535 LNAYLIKNQTTACDQNSWR--------------------GNYSCLQVELTFTRDRAYYFTTVFIP 579
                  ||...|.||.|||                    |:|..:.:....:|...|:....:||
Mouse   205 ------KNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIP 263

  Fly   580 GIILVTSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIY 644
            .|:.|..|:::||::.:|.|||..:|:||:|...|.|...|.:||.||.:|||:::..||..|::
Mouse   264 CILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVF 328

  Fly   645 ASLLEFVCVNY 655
            |:|:|:..:||
Mouse   329 AALMEYATLNY 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 57/264 (22%)
Neur_chan_memb 578..>682 CDD:280999 33/78 (42%)
Gabrg3XP_017177467.1 LIC 50..465 CDD:273305 89/340 (26%)
LGIC_ECD_GABAAR_G 71..252 CDD:349801 46/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.