DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and Gabrg2

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_032099.1 Gene:Gabrg2 / 14406 MGIID:95623 Length:474 Species:Mus musculus


Alignment Length:329 Identity:94/329 - (28%)
Similarity:160/329 - (48%) Gaps:39/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 ILDLLLEKKRYDKRLLPPVNDEDFCCGLQSPDMATNQNARRPHNRGTLTVNVNVLLLSLASPDES 404
            ||:.|||  .||.:|.|.:       |:                :.|| ::.::.:.|:...:..
Mouse    68 ILNNLLE--GYDNKLRPDI-------GV----------------KPTL-IHTDMYVNSIGPVNAI 106

  Fly   405 SLKYEVEFLLNQQWNDPRLQYGNKSHYDFLNALHHHDSIWTPDTYFIMHGDFKDP--IIPMHFAL 467
            :::|.::....|.|.|.||::.:......||: :....||.|||:| .:....|.  |...:..|
Mouse   107 NMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNS-NMVGKIWIPDTFF-RNSKKADAHWITTPNRML 169

  Fly   468 RIFRNGTITYAMRRHLILSCQGSLHIFPFDDPKCSFSMESISYEEAQIKYVWKNDE----DTLRK 528
            ||:.:|.:.|.:|..:...||..||.||.|:..|.....|..|...:|.|.||...    ||  :
Mouse   170 RIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDT--R 232

  Fly   529 SPSLTTLNAYLIKNQTTACDQNSWRGNYSCLQVELTFTRDRAYYFTTVFIPGIILVTSSFITFWL 593
            |..|...:...::|.|......|  |:|..:.|....:|...|:....:||..::|..|:::||:
Mouse   233 SWRLYQFSFVGLRNTTEVVKTTS--GDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWI 295

  Fly   594 EWNAVPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNY-VG 657
            ..:|||||..:|:||:|...|.|...|.:||.||.:|||:::..||..|::::|:|:..::| |.
Mouse   296 NKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVS 360

  Fly   658 RKRP 661
            .::|
Mouse   361 NRKP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 59/231 (26%)
Neur_chan_memb 578..>682 CDD:280999 33/85 (39%)
Gabrg2NP_032099.1 LIC 68..471 CDD:273305 94/329 (29%)
Neur_chan_LBD 68..271 CDD:280998 60/234 (26%)
Neur_chan_memb 278..468 CDD:280999 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.