DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-1 and glra3

DIOPT Version :9

Sequence 1:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_002933371.1 Gene:glra3 / 100488938 XenbaseID:XB-GENE-1011160 Length:449 Species:Xenopus tropicalis


Alignment Length:333 Identity:108/333 - (32%)
Similarity:182/333 - (54%) Gaps:24/333 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 ILDLLLEKKRYDKRLLP-PVNDEDFCCGLQSPDMATNQNAR-RPHNRG-TLTVNVNVLLLSLASP 401
            :|.|:..|:....|..| |::..||...|..  ..:..:|| ||:.:| .:.|..|:.:.|..|.
 Frog    22 LLSLVATKETDSARSRPSPMSPSDFLDKLMG--RTSGYDARIRPNFKGPPVNVTCNIFVNSFGSI 84

  Fly   402 DESSLKYEVEFLLNQQWNDPRLQYGNKSHY--DFL----NALHHHDSIWTPDTYFIMH--GDFKD 458
            .|:::.|.:...|.|:||||||.|   |.|  |.|    :.|   ||||.||.:|...  .:|.:
 Frog    85 AETTMDYRLNIFLRQKWNDPRLAY---SEYPDDSLDLDPSML---DSIWKPDLFFANEKGANFHE 143

  Fly   459 PIIPMHFALRIFRNGTITYAMRRHLILSCQGSLHIFPFDDPKCSFSMESISYEEAQIKYVWKNDE 523
             :...:..||||::|.:.|::|..|.|||...|..||.|...|...:||..|....:.:.|: :.
 Frog   144 -VTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQ-EN 206

  Fly   524 DTLRKSPSLTTLNAYLIKNQTTA--CDQNSWRGNYSCLQVELTFTRDRAYYFTTVFIPGIILVTS 586
            ..::.:..| ||..:::|.:...  |.::...|.::|::|.....|...||...::||.:::|..
 Frog   207 GPVQIADGL-TLPQFVLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVIL 270

  Fly   587 SFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFV 651
            |:::||:..:|.||||.:|:||:|...|.|:|.|::||.||.:.|:::|..||:.|::::|||:.
 Frog   271 SWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYA 335

  Fly   652 CVNYVGRK 659
            .||:|.|:
 Frog   336 AVNFVSRQ 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 70/238 (29%)
Neur_chan_memb 578..>682 CDD:280999 35/82 (43%)
glra3XP_002933371.1 LIC 12..436 CDD:273305 108/333 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614790at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.