DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meru and Rassf8

DIOPT Version :9

Sequence 1:NP_001246779.1 Gene:meru / 39727 FlyBaseID:FBgn0052150 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_082036.1 Gene:Rassf8 / 71323 MGIID:1918573 Length:419 Species:Mus musculus


Alignment Length:403 Identity:77/403 - (19%)
Similarity:128/403 - (31%) Gaps:138/403 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EIPIWMDDGEARYVSGVTNKTTCDDIIKALIDDELRNGNGFYCGNNPKDGGQRKTAAASRDYSDY 188
            |:.:|: ||..|.|.|||..|||.:::.||.....|.|.                         |
Mouse     2 ELKVWV-DGVQRIVCGVTEVTTCQEVVIALAQAIGRTGR-------------------------Y 40

  Fly   189 IITESWGGIERCYDGNMAILPVWRAWSRVHNELRISLKHRDSFRDPLAMQLVPHSQSATGFSMYK 253
            .:.|.|...||                                      .|.||.....  |:.|
Mouse    41 TLIEKWRDTER--------------------------------------HLAPHENPIV--SLNK 65

  Fly   254 W------LKKLLHLKKGKKTPPKPTKTPPKVPNKLKEKRVHGQKQTMTNDLVLVIMPDQLYRGTE 312
            |      ::.:|     ::|.|..::.|                   |:|.|..|....|||   
Mouse    66 WGQYASDVQLIL-----RRTGPSLSERP-------------------TSDSVARIPERTLYR--- 103

  Fly   313 NTAKSKLYKLAENRVSKQRHRRRSRHEIT-------------KASVETFRTAIPSECNNNNYNVN 364
             .:...|.||........|.|...|..:|             |.....||..:.|.|        
Mouse   104 -QSLPPLAKLRPQADKSIRRREPKRKSLTFTGGAKGLTDIFGKGKETEFRQKVLSNC-------- 159

  Fly   365 NCIRRRKDKPLRNSVRYKLASLHADMNVRYEKEHALTRQLSEMCRLYRLQNERYKGPEMELSVGQ 429
                |...:.|:..:|.:...|           .|:.:||.......|...::| ...:|..:.:
Mouse   160 ----RATAEELKRLIRLQTGKL-----------QAIEKQLESSEAEIRFWEQKY-SCSLEEEIVR 208

  Fly   430 LQQNIEAYAEDIIKTEHELLELKNEIKHDISLINNLKRLTLEESEADAACKKGAAKITHPLQENE 494
            |:|.|:....:|.:.|....||:.|.:::..|.:.|:.:..:.::.:...|...|:| |.::...
Mouse   209 LEQRIKRNDVEIEEEEFWENELQIEQENEKQLQDQLEEIRQKVTDCEGRLKDYLAQI-HTMESGL 272

  Fly   495 NTPQVAKNTQEMQ 507
            ...::.:..||.|
Mouse   273 QAEKLHREVQEAQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meruNP_001246779.1 None
Rassf8NP_082036.1 RA_RASSF8 2..83 CDD:340551 29/151 (19%)
Smc 109..>380 CDD:224117 39/202 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15286
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.