DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meru and Rassf7

DIOPT Version :9

Sequence 1:NP_001246779.1 Gene:meru / 39727 FlyBaseID:FBgn0052150 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_080162.3 Gene:Rassf7 / 66985 MGIID:1914235 Length:359 Species:Mus musculus


Alignment Length:415 Identity:81/415 - (19%)
Similarity:141/415 - (33%) Gaps:116/415 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EIPIWMDDGEARYVSGVTNKTTCDDIIKALIDDELRNGNGFYCGNNPKDGGQRKTAAASRDYSDY 188
            |:.:|: ||..|.|.||:.:|||.:::.||                         |.|......:
Mouse     9 ELKVWV-DGIQRVVCGVSEQTTCQEVVIAL-------------------------AQAIGQTGRF 47

  Fly   189 IITESWGGIERCYDGNMAILP------VWRAWSRVHNELRI-------SLKHRDSF-------RD 233
            ::      ::|..:....:||      ......:..|:::.       ||..|.|.       |.
Mouse    48 VL------VQRLREKERQLLPQECPVGAQATCGQFANDVQFVLRRTGPSLSGRPSSDNCPPPERC 106

  Fly   234 PLAMQLVPHSQSATGFSMYKWLKKLLHLKKGKKTP--PKPTKTPPKVPNKLKEKRVHGQKQTMTN 296
            |:...|.|...:..|....|.|...|...|...:|  |:|......:|:...:          ..
Mouse   107 PVRASLPPKPSAIPGREPRKALTFNLRCPKLVPSPSIPEPAALVGPIPDGFAD----------LQ 161

  Fly   297 DLVLVIMPDQLYRGTENTAKSKLYKLAENRVSKQRHRRRSRHEITKASVETFRTAIPSECNNNNY 361
            ||.|     ::.|.||.......::....|  :|...|..:..:...|..|...|...|      
Mouse   162 DLEL-----RIQRNTEELGHEAFWEQELQR--EQAREREGQARLQALSAATAEHAARLE------ 213

  Fly   362 NVNNCIRRRKDKPLRNSVRYKLASLHADMNVRYEK--EHALTRQLSEMCRLYRLQNERYKGPEME 424
                            ::..:..:|.|::.:..|.  ..:.|...:|..|......||: ..||:
Mouse   214 ----------------ALDAQACALEAELRLAAEAPGPPSATASAAERLRQDLATQERH-SLEMQ 261

  Fly   425 LSVGQLQQNIEAYAEDIIKTE-HELLELKNEIKHDISLINNLKRLTLEESEADAACKKGAAKITH 488
            .::..:.|.:|| ||..::.: .||.||..|::.     .||::...:         .|||....
Mouse   262 GTLALVSQALEA-AEHALQAQAQELEELNRELRQ-----CNLQQFIQQ---------TGAALPPP 311

  Fly   489 PLQENENTPQ----VAKNTQEMQFV 509
            |.|.:...|.    ::.|..|:|.|
Mouse   312 PPQLDRTIPSTQDLLSPNRGELQGV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meruNP_001246779.1 None
Rassf7NP_080162.3 RA_RASSF7 8..90 CDD:340552 19/112 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..123 9/35 (26%)
SMC_prok_B <158..>334 CDD:274008 43/230 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15286
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.