DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meru and Rassf9

DIOPT Version :9

Sequence 1:NP_001246779.1 Gene:meru / 39727 FlyBaseID:FBgn0052150 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_075248.1 Gene:Rassf9 / 65053 RGDID:621329 Length:435 Species:Rattus norvegicus


Alignment Length:416 Identity:88/416 - (21%)
Similarity:151/416 - (36%) Gaps:124/416 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 APPHRQACKNKHGRENGNAGQASRRHRSISLYGVNSTVEQGHKEIPIWMDDGEARYVSGVTNKTT 145
            ||..|...|.:|            ::||     ....::...|||.:|:.. |.:.|.|:|.:||
  Rat     2 APFGRNLLKTRH------------KNRS-----PTKDMDPEEKEIVVWVCQ-EEKIVCGLTKRTT 48

  Fly   146 CDDIIKALIDDELRNGNGFYCGNNPKDGGQRKTAAASRDYSDYIITESWGGIERCYDGNMAILPV 210
            ..|:|:||:::            :....|:::......  |||.|.|.|.|.||.......||.:
  Rat    49 SIDVIQALLEE------------HEATFGEKRFLLGKA--SDYCIVEKWRGSERALPPLTRILKL 99

  Fly   211 WRAWSRVHNELRISLKHRDSFRD-PL----AMQLVPHSQSATGFSMYKWLKKLLHLKKGKKTPPK 270
            |:||......::..|...|:|.. ||    ..:||.:::.....|...::|.|            
  Rat   100 WKAWGDEQPNMQFVLVKTDAFLPVPLWRTAETKLVQNNEKPWELSPANYMKTL------------ 152

  Fly   271 PTKTPPKVPNKLKEKRVHGQKQTMTNDLVLVIMPDQLYRGTENTAKSKLYKLAENRVSKQRHRRR 335
                ||.     |:||:                           .:....|||:.|.....|.|.
  Rat   153 ----PPD-----KQKRI---------------------------VRKTFRKLAKIRQDTGSHDRD 181

  Fly   336 SRHEITKASVETFRTAIPSECNNNNYNVNNCIRRRKDKPLRNSVRYKLASLHADM----NVRYEK 396
            :...:....:            :.::.::..::|.|:  |...:....|.:|.|.    ...|.:
  Rat   182 NMECLVHLII------------SQDHTIHQQVQRMKE--LDMEIEKCEAKIHLDRIGNDGADYVQ 232

  Fly   397 EHALTRQLSEMCRLYRLQNERYKGPEMELS----VGQLQQNIEAYAEDIIKTEHELLELKNEIK- 456
            |..|..:.||..:....|:|..:..| :|:    |.||::.::.|...|.|..   .|::.|:| 
  Rat   233 EAYLMPRSSEEEQKLDFQSEDNQTLE-DLNDGEGVSQLEEQLQYYRALIDKLS---AEIEREVKG 293

  Fly   457 --HDISLINNLKRLTLEESEADAACK 480
              .|.|          |:.|..|||:
  Rat   294 AGTDGS----------EDMEGAAACE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meruNP_001246779.1 None
Rassf9NP_075248.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 7/36 (19%)
RA 23..118 CDD:214612 30/109 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..423
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003658
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.