DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meru and Rassf10

DIOPT Version :9

Sequence 1:NP_001246779.1 Gene:meru / 39727 FlyBaseID:FBgn0052150 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_017445691.1 Gene:Rassf10 / 308894 RGDID:1309847 Length:507 Species:Rattus norvegicus


Alignment Length:443 Identity:89/443 - (20%)
Similarity:153/443 - (34%) Gaps:132/443 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VEQGHKEIPIWMDDGEARYVSGVTNKTTCDDIIKALIDD----ELRNGNGFYCGNNPKDGGQ--- 175
            ::...|:|.:|:.. |.:.|||::.:|||.|:::.|::|    ..|...|...|......||   
  Rat     1 MDPSEKKISVWICQ-EEKLVSGLSRRTTCSDVVRVLLEDGCRRRCRQRRGQRRGLTEDPSGQLGL 64

  Fly   176 -RKTAAASRDYSD-------------YIITESWGGIERCYDGNMAILPVWRAWSRVHNELRISLK 226
             ........|..|             |.|.|.|.|.||.......||.:|.||......:|..|.
  Rat    65 PEPPDENDEDDDDAMPQGMLCGPPQCYCIVEKWRGFERILPNKTRILRLWTAWGDEQENVRFVLV 129

  Fly   227 HRDSFRDPLAMQLVPHSQSATGFSMYKWLKKLLHLKKGKKTPPKPTKTPPKVPNKLKEKRVHGQK 291
            ..::        .:|::...:..:.....::...|.:|  .|.:|:                   
  Rat   130 RSEA--------SLPNAGPRSAEARVVLSRERPCLARG--APARPS------------------- 165

  Fly   292 QTMTNDLVLVIMPDQLYRGTENTAKSKLYKLAENRVSKQRHRRRSRHEITKASVETFRTAIPSEC 356
                     :.:..:..|.....|..||.||         :|||.:...:..|..:..||  |.|
  Rat   166 ---------LALTQEKQRRVVRKAFRKLAKL---------NRRRQQQPSSPCSSTSSSTA--SSC 210

  Fly   357 NNNNYNVNNCIRRR----------KDKPLRNSVRYKLASLHADMNVRYE-KEHALTRQLSEMCR- 409
            :::.....:....|          :|..:|..|: :|..|..::: ||| |.|     |..|.| 
  Rat   211 SSSPRTHESASVERMETLVHLVLSQDHTIRQQVQ-RLRELDREID-RYEAKVH-----LDRMRRH 268

  Fly   410 -LYRLQNERYKG---------PEMELSVGQLQQNIEAYA-----------EDIIKTEHELLELKN 453
             :..:|:....|         ||.|.....|::..||.|           |::.:...:|:.|:.
  Rat   269 GVNYVQDTYLVGADLDLDRPTPEKEPEDATLEEKTEAAAPLDGEAQAAALEELARRCDDLVRLQE 333

  Fly   454 EIKHDISLINNLKRLTLEESEADAACKKGAAKITHPLQENENTPQVAKNTQEM 506
            |......|   |:||:.|                  :||..|...:.:..:|:
  Rat   334 ERAQQEEL---LERLSAE------------------IQEELNQRWMQRRNEEL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meruNP_001246779.1 None
Rassf10XP_017445691.1 UBQ <88..132 CDD:294102 14/43 (33%)
End3 <329..431 CDD:289527 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003658
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.