DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meru and Rassf7

DIOPT Version :9

Sequence 1:NP_001246779.1 Gene:meru / 39727 FlyBaseID:FBgn0052150 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001099787.1 Gene:Rassf7 / 293623 RGDID:1306244 Length:357 Species:Rattus norvegicus


Alignment Length:407 Identity:73/407 - (17%)
Similarity:141/407 - (34%) Gaps:112/407 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EIPIWMDDGEARYVSGVTNKTTCDDIIKALIDDELRNGNGFYCGNNPKDGGQRKTAAASRDYSDY 188
            |:.:|: ||..|.|.||:.:|||.:::.||                         |.|......:
  Rat     9 ELKVWV-DGIQRVVCGVSEQTTCQEVVIAL-------------------------AQAIGQTGRF 47

  Fly   189 IITESWGGIERCYDGNMAILP------VWRAWSRVHNELRI-------SLKHRDSF-------RD 233
            ::      ::|..:....:||      ......:..|:::.       ||..|.|.       |.
  Rat    48 VL------VQRLREKERQLLPQECPVGAQATCGQFANDVQFVLRRTGPSLSGRPSSDNCPPPERC 106

  Fly   234 PLAMQLVPHSQSATGFSMYKWLKKLLHLKKGKKTP--PKPTKTPPKVPNKLKEKRVHGQKQTMTN 296
            |:...|.|.:.:..|....|.|...|...:...:|  |:||.....:|:...:            
  Rat   107 PVRASLPPKAGATPGREPRKPLTFNLGCPRLVPSPSVPEPTALVGPIPDCFAD------------ 159

  Fly   297 DLVLVIMPDQLYRGTENTAKSKLYKLAENRVSKQRHRRRSRHEITKASVETFRTAIPSECNNNNY 361
               |..:..::.|.||.......::       ::..|.::|.:..:|.::....|.......   
  Rat   160 ---LQSLELRIQRNTEELGHEAFWE-------QELQREQAREQEGQARLQALSAATAEHAAR--- 211

  Fly   362 NVNNCIRRRKDKPLRNSVRYKLASLHADMNVRYEK--EHALTRQLSEMCRLYRLQNERYKGPEME 424
                          ..::..:..:|.|::.:..|.  ..:.|...:|..|......||: ..||:
  Rat   212 --------------LEALDAQACALEAELRLAAEAPGPPSATASAAERLRQDLAIQERH-SLEMQ 261

  Fly   425 LSVGQLQQNIEAYAEDIIKTE-HELLELKNEIKHDISLINNLKRLTLEESEADAACKKGAAKITH 488
            .::..:.|.:|| ||..::.: .||.||..|::.     .||::...:         .|||....
  Rat   262 GTLALVSQALEA-AEHALQAQAQELEELNRELRQ-----CNLQQFIQQ---------TGAALPPP 311

  Fly   489 PLQENENTPQVAKNTQE 505
            |..:..:|..:...|:|
  Rat   312 PQLDRTSTQDLPPPTRE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meruNP_001246779.1 None
Rassf7NP_001099787.1 RA_RASSF7 8..90 CDD:340552 19/112 (17%)
SbcC <157..>296 CDD:223496 28/184 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15286
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.