DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meru and RASSF8

DIOPT Version :9

Sequence 1:NP_001246779.1 Gene:meru / 39727 FlyBaseID:FBgn0052150 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001158218.1 Gene:RASSF8 / 11228 HGNCID:13232 Length:419 Species:Homo sapiens


Alignment Length:408 Identity:78/408 - (19%)
Similarity:159/408 - (38%) Gaps:73/408 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EIPIWMDDGEARYVSGVTNKTTCDDIIKALIDDELRNGNGFYCGNNPKDGGQRKTAAASRDYSDY 188
            |:.:|: ||..|.|.|||..|||.:::.||.....|.|.                         |
Human     2 ELKVWV-DGVQRIVCGVTEVTTCQEVVIALAQAIGRTGR-------------------------Y 40

  Fly   189 IITESWGGIERCYDGNMAILPVWRAWSRVHNELRISLKHRDSFRDPLAMQLVPH-SQSATGFSMY 252
            .:.|.|...||....:...:.....|.:..:::::.|:...           |. |:..|..|:.
Human    41 TLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTG-----------PSLSERPTSDSVA 94

  Fly   253 KWLKKLLHLKKGKKTPPKPTKTPPKVPNKLKEKRVHGQKQTMTNDLVLVIMPDQLYRGTENTAKS 317
            :..::.|:    :::.|...|..|::...:|.:....:..|.|.....::  |...:|.|...|.
Human    95 RIPERTLY----RQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAKGLM--DIFGKGKETEFKQ 153

  Fly   318 KLY---KLAENRVSKQRHRRRSRHEITKASVETFRTAIPSECNNNNYNVNNCIRRRKDKPLRNSV 379
            |:.   |...:.:.|....:..:.:..:..:|:....|.......|.|:...|.|.:.|..||.|
Human   154 KVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLEQKIKRNDV 218

  Fly   380 RYKLASL-HADMNVRYEKEHALTRQLSEM-CRLYRLQNE------RYKGPEMELSVGQLQQNIEA 436
            ..:.... ..::.:..|.|..|..||.|: .::...:|:      :.:..|..|...:||:.::.
Human   219 EIEEEEFWENELQIEQENEKQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQREVQE 283

  Fly   437 YAEDIIKTEHELLELKNEI----KHDISLINNLKRLTLEESEADAACKKGAAKITHPLQENENTP 497
            ...:..:.:.::.::|.||    :..:.|.|.:|           |.::...:.|..||:.|.  
Human   284 AQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIK-----------AVERSLGQATKRLQDKEQ-- 335

  Fly   498 QVAKNTQEMQFVDNIYEF 515
            ::.:.|:|::.| |:.:|
Human   336 ELEQLTKELRQV-NLQQF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meruNP_001246779.1 None
RASSF8NP_001158218.1 RA_RASSF8 2..83 CDD:340551 23/117 (20%)
Smc <160..>351 CDD:224117 38/204 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15286
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.