DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and AT5G16470

DIOPT Version :9

Sequence 1:NP_001246778.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001332259.1 Gene:AT5G16470 / 831508 AraportID:AT5G16470 Length:104 Species:Arabidopsis thaliana


Alignment Length:83 Identity:26/83 - (31%)
Similarity:34/83 - (40%) Gaps:27/83 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QAKLKKQQGHSANDQKKAAQKALV----------------------YVCAVCKSQMPDPKTYKQH 60
            :||.||   |:|.:.:..|..||.                      |.|..||..:||.||.:.|
plant     4 KAKPKK---HTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITVPDLKTMQIH 65

  Fly    61 FENKHPK--NDIPEELKE 76
            .|:||||  .:.|..|.|
plant    66 HESKHPKLTYEEPRNLHE 83



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1620202at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21213
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.980

Return to query results.
Submit another query.