DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and ZNF706

DIOPT Version :9

Sequence 1:NP_001246778.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001035975.1 Gene:ZNF706 / 51123 HGNCID:24992 Length:76 Species:Homo sapiens


Alignment Length:77 Identity:50/77 - (64%)
Similarity:61/77 - (79%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPKTYKQHFENKH 65
            ||||.||||||.|.::|||..||:|||   |||.||:.||:|.|.||::|||||||:|||||:||
Human     1 MARGQQKIQSQQKNAKKQAGQKKKQGH---DQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKH 62

  Fly    66 PKNDIPEELKEV 77
            ||..:|.||.:|
Human    63 PKTPLPPELADV 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15715NP_001246778.1 None
ZNF706NP_001035975.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 22/33 (67%)
zf-C2H2_12 <41..>65 CDD:408440 18/23 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..76 14/22 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158689
Domainoid 1 1.000 47 1.000 Domainoid score I12019
eggNOG 1 0.900 - - E1_KOG4118
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128235
Inparanoid 1 1.050 106 1.000 Inparanoid score I4937
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49014
OrthoDB 1 1.010 - - D1620202at2759
OrthoFinder 1 1.000 - - FOG0003631
OrthoInspector 1 1.000 - - otm41695
orthoMCL 1 0.900 - - OOG6_105601
Panther 1 1.100 - - O PTHR21213
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2504
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.