DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and Zfp706

DIOPT Version :9

Sequence 1:NP_001246778.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001381303.1 Gene:Zfp706 / 500855 RGDID:1563959 Length:76 Species:Rattus norvegicus


Alignment Length:77 Identity:50/77 - (64%)
Similarity:61/77 - (79%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPKTYKQHFENKH 65
            ||||.||||||.|.::|||..||:|||   |||.||:.||:|.|.||::|||||||:|||||:||
  Rat     1 MARGQQKIQSQQKNAKKQAGQKKKQGH---DQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKH 62

  Fly    66 PKNDIPEELKEV 77
            ||..:|.||.:|
  Rat    63 PKTPLPPELADV 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15715NP_001246778.1 None
Zfp706NP_001381303.1 zf-C2H2_12 <41..>65 CDD:408440 18/23 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11685
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4838
OMA 1 1.010 - - QHG49014
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003631
OrthoInspector 1 1.000 - - otm45824
orthoMCL 1 0.900 - - OOG6_105601
Panther 1 1.100 - - O PTHR21213
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2504
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.