DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and znf706

DIOPT Version :9

Sequence 1:NP_001246778.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001185818.1 Gene:znf706 / 402905 ZFINID:ZDB-GENE-040718-454 Length:76 Species:Danio rerio


Alignment Length:77 Identity:52/77 - (67%)
Similarity:65/77 - (84%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPKTYKQHFENKH 65
            |||||||||||.|.::|||::||.:||   |||.||:.|||:.||||:||||||||:|||||:||
Zfish     1 MARGHQKIQSQQKNAKKQAEIKKSKGH---DQKTAAKAALVFTCAVCRSQMPDPKTFKQHFESKH 62

  Fly    66 PKNDIPEELKEV 77
            ||:.:|.||:.|
Zfish    63 PKSPLPPELEGV 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15715NP_001246778.1 None
znf706NP_001185818.1 4F5 1..37 CDD:282298 24/38 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594644
Domainoid 1 1.000 50 1.000 Domainoid score I11705
eggNOG 1 0.900 - - E1_KOG4118
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128235
Inparanoid 1 1.050 111 1.000 Inparanoid score I4850
OMA 1 1.010 - - QHG49014
OrthoDB 1 1.010 - - D1620202at2759
OrthoFinder 1 1.000 - - FOG0003631
OrthoInspector 1 1.000 - - otm25707
orthoMCL 1 0.900 - - OOG6_105601
Panther 1 1.100 - - O PTHR21213
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2504
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.