DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and CG18081

DIOPT Version :10

Sequence 1:NP_648808.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_648807.1 Gene:CG18081 / 39725 FlyBaseID:FBgn0036537 Length:77 Species:Drosophila melanogaster


Alignment Length:77 Identity:75/77 - (97%)
Similarity:77/77 - (100%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPKTYKQHFENKH 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPKTYKQHFENKH 65

  Fly    66 PKNDIPEELKEV 77
            ||||:|:|||||
  Fly    66 PKNDMPDELKEV 77

Return to query results.
Submit another query.