DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15715 and znf-706

DIOPT Version :9

Sequence 1:NP_001246778.1 Gene:CG15715 / 39726 FlyBaseID:FBgn0036538 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_501583.1 Gene:znf-706 / 177731 WormBaseID:WBGene00007223 Length:73 Species:Caenorhabditis elegans


Alignment Length:76 Identity:46/76 - (60%)
Similarity:55/76 - (72%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQMPDPKTYKQHFENKH 65
            ||||.||||||.| ::|:|...::.|   .|||.||.|||.:.|.||.:.|||||||||||||||
 Worm     1 MARGQQKIQSQQK-NQKKADAARKAG---IDQKAAAAKALNHKCTVCLAMMPDPKTYKQHFENKH 61

  Fly    66 PKNDIPEELKE 76
            ||:.:|.||.|
 Worm    62 PKSPLPAELVE 72



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166249
Domainoid 1 1.000 61 1.000 Domainoid score I6916
eggNOG 1 0.900 - - E1_KOG4118
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I3636
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49014
OrthoDB 1 1.010 - - D1620202at2759
OrthoFinder 1 1.000 - - FOG0003631
OrthoInspector 1 1.000 - - mtm4855
orthoMCL 1 0.900 - - OOG6_105601
Panther 1 1.100 - - LDO PTHR21213
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2504
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.