DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18081 and AT5G16470

DIOPT Version :10

Sequence 1:NP_648807.1 Gene:CG18081 / 39725 FlyBaseID:FBgn0036537 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_197151.1 Gene:AT5G16470 / 831508 AraportID:AT5G16470 Length:104 Species:Arabidopsis thaliana


Alignment Length:83 Identity:26/83 - (31%)
Similarity:34/83 - (40%) Gaps:27/83 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QAKLKKQQGHSANDQKKAAQKALV----------------------YVCAVCKSQMPDPKTYKQH 60
            :||.||   |:|.:.:..|..||.                      |.|..||..:||.||.:.|
plant     4 KAKPKK---HTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITVPDLKTMQIH 65

  Fly    61 FENKHPK--NDMPDELKE 76
            .|:||||  .:.|..|.|
plant    66 HESKHPKLTYEEPRNLHE 83

Return to query results.
Submit another query.