DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and rppH

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_417307.1 Gene:rppH / 947300 ECOCYCID:G7459 Length:176 Species:Escherichia coli


Alignment Length:38 Identity:15/38 - (39%)
Similarity:21/38 - (55%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 FARNSWGFPKGKINENEDPAHCATREVYEETGFDITDL 369
            |.::||.||:|.||..|.......||::||.|....|:
E. coli    28 FGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDV 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 15/38 (39%)
rppHNP_417307.1 PRK00714 1..156 CDD:234820 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.