DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and DDP1

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_014806.1 Gene:DDP1 / 854334 SGDID:S000005689 Length:188 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:25/104 - (24%)
Similarity:44/104 - (42%) Gaps:23/104 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 GAILVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAH--CATREVYEETGF---------DIT 367
            |.|.::.|....|::.|...:..|..|||.: |.::|.:  .|.||.:||.|.         .:.
Yeast    36 GCICLTPDKKQVLMITSSAHKKRWIVPKGGV-EKDEPNYETTAQRETWEEAGCIGKIVANLGTVE 99

  Fly   368 DLIDANDYIEAFINYQYTRLYVVRNIPMDTQFA---PRT 403
            |:....|:.:....::.:|        .|::.|   |||
Yeast   100 DMRPPKDWNKDIKQFENSR--------KDSEVAKHPPRT 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 25/104 (24%)
DDP1NP_014806.1 NUDIX_DIPP2_like_Nudt4 33..181 CDD:467551 25/104 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.